Warenkorb

Produktsuche

Home
Produkte
WBP11 Rabbit Polyclonal Antibody, Unconjugated

WBP11 Rabbit Polyclonal Antibody, Unconjugated

Artikelnummer: BYT-ORB325262

Bilder (5)
Sehen Sie alle Bilder und Bildinformationen

Artikelname:	WBP11 Rabbit Polyclonal Antibody, Unconjugated
Artikelnummer:	BYT-ORB325262
Hersteller Artikelnummer:	orb325262
Alternativnummer:	BYT-ORB325262-100
Hersteller:	Biorbyt
Wirt:	Rabbit
Kategorie:	Antikörper
Applikation:	IHC, IP, WB
Spezies Reaktivität:	Human, Mouse
Immunogen:	The immunogen is a synthetic peptide directed towards the N terminal region of human WBP11
Konjugation:	Unconjugated
Alternative Synonym:	anti DKFZp779M1063 antibody, anti NPWBP antibody, anti SIPP1 antibody, anti WBP-11 antibody

Rabbit polyclonal antibody to WBP11

Klonalität:	Polyclonal
Konzentration:	0.5 mg/ml
Molekulargewicht:	70kDa
NCBI:	057396
UniProt:	Q9Y2W2
Puffer:	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Formulierung:	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequenz:	Synthetic peptide located within the following region: GRRSTSSTKSGKFMNPTDQARKEARKRELKKNKKQRMMVRAAVLKMKDPK
Target-Kategorie:	WBP11

	Amount and Sample Type: 500 ug mouse brain homogenate, Amount of IP Antibody: 6 ug, Primary Antibody: WBP11, Primary Antibody Dilution: 1:500, Secondary Antibody: Goat anti-rabbit Alexa-Fluor 594, Secondary Antibody Dilution: 1:5000, Gene Name: WBP11.
	Sample Type: Jurkat, Antibody Dilution: 1.0 ug/mL, WBP11 is strongly supported by BioGPS gene expression data to be expressed in Jurkat.
	Lanes: 1. Human NT-2 cells (60 ug) lysate 2. Mouse WT brain extract (80 ug), Primary Antibody Dilution: 2 ug/mL, Secondary Antibody: IRDye 800CW goat anti-rabbit, Secondary Antibody Dilution: 1:20000, Gene Name: WBP11.
	Rabbit Anti-WBP11 Antibody, Catalog Number: orb325262, Formalin Fixed Paraffin Embedded Tissue: Human Pineal Tissue, Observed Staining: Cytoplasmic in cell bodies of pinealocytes and their processes, Primary Antibody Concentration: 1:100, Other Working Concentrations: 1/600, Secondary Antibody: Donkey anti-Rabbit-Cy3, Secondary Antibody Concentration: 1:200, Magnification: 20X, Exposure Time: 0.5 - 2.0 sec.
	WB Suggested Anti-WBP11 Antibody Titration: 0.2-1 ug/mL, ELISA Titer: 1:12500, Positive Control: Hela cell lysate, WBP11 is strongly supported by BioGPS gene expression data to be expressed in Human HeLa cells.

* Mehrwertsteuer und Versandkosten nicht enthalten.
Irrtümer und Preisänderungen vorbehalten