WBP11 Rabbit Polyclonal Antibody, Unconjugated

Catalog Number: BYT-ORB325262
Article Name: WBP11 Rabbit Polyclonal Antibody, Unconjugated
Biozol Catalog Number: BYT-ORB325262
Supplier Catalog Number: orb325262
Alternative Catalog Number: BYT-ORB325262-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: IHC, IP, WB
Species Reactivity: Human, Mouse
Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human WBP11
Conjugation: Unconjugated
Alternative Names: anti DKFZp779M1063 antibody, anti NPWBP antibody, anti SIPP1 antibody, anti WBP-11 antibody
Rabbit polyclonal antibody to WBP11
Clonality: Polyclonal
Concentration: 0.5 mg/ml
Molecular Weight: 70kDa
NCBI: 057396
UniProt: Q9Y2W2
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Form: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence: Synthetic peptide located within the following region: GRRSTSSTKSGKFMNPTDQARKEARKRELKKNKKQRMMVRAAVLKMKDPK
Target: WBP11
Amount and Sample Type: 500 ug mouse brain homogenate, Amount of IP Antibody: 6 ug, Primary Antibody: WBP11, Primary Antibody Dilution: 1:500, Secondary Antibody: Goat anti-rabbit Alexa-Fluor 594, Secondary Antibody Dilution: 1:5000, Gene Name: WBP11.
Sample Type: Jurkat, Antibody Dilution: 1.0 ug/mL, WBP11 is strongly supported by BioGPS gene expression data to be expressed in Jurkat.
Lanes: 1. Human NT-2 cells (60 ug) lysate 2. Mouse WT brain extract (80 ug), Primary Antibody Dilution: 2 ug/mL, Secondary Antibody: IRDye 800CW goat anti-rabbit, Secondary Antibody Dilution: 1:20000, Gene Name: WBP11.
Rabbit Anti-WBP11 Antibody, Catalog Number: orb325262, Formalin Fixed Paraffin Embedded Tissue: Human Pineal Tissue, Observed Staining: Cytoplasmic in cell bodies of pinealocytes and their processes, Primary Antibody Concentration: 1:100, Other Working Concentrations: 1/600, Secondary Antibody: Donkey anti-Rabbit-Cy3, Secondary Antibody Concentration: 1:200, Magnification: 20X, Exposure Time: 0.5 - 2.0 sec.
WB Suggested Anti-WBP11 Antibody Titration: 0.2-1 ug/mL, ELISA Titer: 1:12500, Positive Control: Hela cell lysate, WBP11 is strongly supported by BioGPS gene expression data to be expressed in Human HeLa cells.
577,00 €
100 ul
* VAT and and shipping costs not included.
Errors and price changes excepted
Availability
ORDER BY EMAIL
Product Guarantee and Expert Support
BIOZOL