GALNAC4S-6ST Rabbit Polyclonal Antibody, Unconjugated

Artikelnummer: BYT-ORB325320
Artikelname: GALNAC4S-6ST Rabbit Polyclonal Antibody, Unconjugated
Artikelnummer: BYT-ORB325320
Hersteller Artikelnummer: orb325320
Alternativnummer: BYT-ORB325320-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Human
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human GALNAC4S-6ST
Konjugation: Unconjugated
Alternative Synonym: anti BRAG antibody, anti DKFZp781H1369 antibody, anti KIAA0598 antibody, anti MGC34346 antibody, anti RP11-47G11.1 antibody, anti GALNAC4S-6ST antibody
Rabbit polyclonal antibody to CHST15
Klonalität: Polyclonal
Konzentration: 0.5 mg/ml
Molekulargewicht: 65 kDa
NCBI: 056976
UniProt: Q7LFX5
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequenz: Synthetic peptide located within the following region: YDNSTDGEPPFLTQDFIHAFQPNARLIVMLRDPVERLYSDYLYFASSNKS
Target-Kategorie: CHST15
25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 3 ug/mL of the antibody was used in this experiment.
Sample Type: Human Fetal Heart, Antibody Dilution: 1.0 ug/mL.
Sample Type: Human Fetal Lung, Antibody Dilution: 1.0 ug/mL.
Sample Type: MCF7, Antibody Dilution: 1.0 ug/mL, CHST15 is supported by BioGPS gene expression data to be expressed in MCF7.
WB Suggested Anti-GALNAC4S-6ST Antibody Titration: 0.2-1 ug/mL, ELISA Titer: 1:12500, Positive Control: Hela cell lysate.