GALNAC4S-6ST Rabbit Polyclonal Antibody, Unconjugated

Catalog Number: BYT-ORB325320
Article Name: GALNAC4S-6ST Rabbit Polyclonal Antibody, Unconjugated
Biozol Catalog Number: BYT-ORB325320
Supplier Catalog Number: orb325320
Alternative Catalog Number: BYT-ORB325320-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Species Reactivity: Human
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human GALNAC4S-6ST
Conjugation: Unconjugated
Alternative Names: anti BRAG antibody, anti DKFZp781H1369 antibody, anti KIAA0598 antibody, anti MGC34346 antibody, anti RP11-47G11.1 antibody, anti GALNAC4S-6ST antibody
Rabbit polyclonal antibody to CHST15
Clonality: Polyclonal
Concentration: 0.5 mg/ml
Molecular Weight: 65 kDa
NCBI: 056976
UniProt: Q7LFX5
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Form: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence: Synthetic peptide located within the following region: YDNSTDGEPPFLTQDFIHAFQPNARLIVMLRDPVERLYSDYLYFASSNKS
Target: CHST15
25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 3 ug/mL of the antibody was used in this experiment.
Sample Type: Human Fetal Heart, Antibody Dilution: 1.0 ug/mL.
Sample Type: Human Fetal Lung, Antibody Dilution: 1.0 ug/mL.
Sample Type: MCF7, Antibody Dilution: 1.0 ug/mL, CHST15 is supported by BioGPS gene expression data to be expressed in MCF7.
WB Suggested Anti-GALNAC4S-6ST Antibody Titration: 0.2-1 ug/mL, ELISA Titer: 1:12500, Positive Control: Hela cell lysate.