C3orf64 Rabbit Polyclonal Antibody, Unconjugated

Artikelnummer: BYT-ORB325443
Artikelname: C3orf64 Rabbit Polyclonal Antibody, Unconjugated
Artikelnummer: BYT-ORB325443
Hersteller Artikelnummer: orb325443
Alternativnummer: BYT-ORB325443-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Human
Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human C3orf64
Konjugation: Unconjugated
Alternative Synonym: anti AER61 antibody, anti FLJ13078 antibody, anti FLJ33770 antibody, anti FLJ41219 antibody, anti MGC34132 antibody, anti C3orf64 antibody
Rabbit polyclonal antibody to EOGT
Klonalität: Polyclonal
Konzentration: 0.5 mg/ml
Molekulargewicht: 52kDa
NCBI: 775925
UniProt: Q5NDL2
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequenz: Synthetic peptide located within the following region: GHHPTLGEHPKFTNYSFDVEEFMYLVLQAADHVLQHPKWPFKKKHDEL
Target-Kategorie: EOGT
Sample Tissue: Human HepG2 Whole Cell, Antibody Dilution: 3 ug/mL.
Sample Tissue: Human HepG2 Whole Cell, Antibody Dilution: 3 ug/mL.
Sample Tissue: Human HepG2 Whole Cell, Antibody Dilution: 3 ug/mL.
Sample Tissue: Human Jurkat Whole Cell, Antibody Dilution: 1 ug/mL.
WB Suggested Anti-C3orf64 Antibody Titration: 0.2-1 ug/mL, Positive Control: Human brain.