C3orf64 Rabbit Polyclonal Antibody, Unconjugated
Artikelnummer:
BYT-ORB325443
| Artikelname: |
C3orf64 Rabbit Polyclonal Antibody, Unconjugated |
| Artikelnummer: |
BYT-ORB325443 |
| Hersteller Artikelnummer: |
orb325443 |
| Alternativnummer: |
BYT-ORB325443-100 |
| Hersteller: |
Biorbyt |
| Wirt: |
Rabbit |
| Kategorie: |
Antikörper |
| Applikation: |
WB |
| Spezies Reaktivität: |
Human |
| Immunogen: |
The immunogen is a synthetic peptide directed towards the C terminal region of human C3orf64 |
| Konjugation: |
Unconjugated |
| Alternative Synonym: |
anti AER61 antibody, anti FLJ13078 antibody, anti FLJ33770 antibody, anti FLJ41219 antibody, anti MGC34132 antibody, anti C3orf64 antibody |
| Rabbit polyclonal antibody to EOGT |
| Klonalität: |
Polyclonal |
| Konzentration: |
0.5 mg/ml |
| Molekulargewicht: |
52kDa |
| NCBI: |
775925 |
| UniProt: |
Q5NDL2 |
| Puffer: |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Formulierung: |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Sequenz: |
Synthetic peptide located within the following region: GHHPTLGEHPKFTNYSFDVEEFMYLVLQAADHVLQHPKWPFKKKHDEL |
| Target-Kategorie: |
EOGT |
|
Sample Tissue: Human HepG2 Whole Cell, Antibody Dilution: 3 ug/mL. |
|
Sample Tissue: Human HepG2 Whole Cell, Antibody Dilution: 3 ug/mL. |
|
Sample Tissue: Human HepG2 Whole Cell, Antibody Dilution: 3 ug/mL. |
|
Sample Tissue: Human Jurkat Whole Cell, Antibody Dilution: 1 ug/mL. |
|
WB Suggested Anti-C3orf64 Antibody Titration: 0.2-1 ug/mL, Positive Control: Human brain. |