C3orf64 Rabbit Polyclonal Antibody, Unconjugated
Catalog Number:
BYT-ORB325443
| Article Name: |
C3orf64 Rabbit Polyclonal Antibody, Unconjugated |
| Biozol Catalog Number: |
BYT-ORB325443 |
| Supplier Catalog Number: |
orb325443 |
| Alternative Catalog Number: |
BYT-ORB325443-100 |
| Manufacturer: |
Biorbyt |
| Host: |
Rabbit |
| Category: |
Antikörper |
| Application: |
WB |
| Species Reactivity: |
Human |
| Immunogen: |
The immunogen is a synthetic peptide directed towards the C terminal region of human C3orf64 |
| Conjugation: |
Unconjugated |
| Alternative Names: |
anti AER61 antibody, anti FLJ13078 antibody, anti FLJ33770 antibody, anti FLJ41219 antibody, anti MGC34132 antibody, anti C3orf64 antibody |
| Rabbit polyclonal antibody to EOGT |
| Clonality: |
Polyclonal |
| Concentration: |
0.5 mg/ml |
| Molecular Weight: |
52kDa |
| NCBI: |
775925 |
| UniProt: |
Q5NDL2 |
| Buffer: |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Form: |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Sequence: |
Synthetic peptide located within the following region: GHHPTLGEHPKFTNYSFDVEEFMYLVLQAADHVLQHPKWPFKKKHDEL |
| Target: |
EOGT |
|
Sample Tissue: Human HepG2 Whole Cell, Antibody Dilution: 3 ug/mL. |
|
Sample Tissue: Human HepG2 Whole Cell, Antibody Dilution: 3 ug/mL. |
|
Sample Tissue: Human HepG2 Whole Cell, Antibody Dilution: 3 ug/mL. |
|
Sample Tissue: Human Jurkat Whole Cell, Antibody Dilution: 1 ug/mL. |
|
WB Suggested Anti-C3orf64 Antibody Titration: 0.2-1 ug/mL, Positive Control: Human brain. |