C3orf64 Rabbit Polyclonal Antibody, Unconjugated

Catalog Number: BYT-ORB325443
Article Name: C3orf64 Rabbit Polyclonal Antibody, Unconjugated
Biozol Catalog Number: BYT-ORB325443
Supplier Catalog Number: orb325443
Alternative Catalog Number: BYT-ORB325443-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Species Reactivity: Human
Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human C3orf64
Conjugation: Unconjugated
Alternative Names: anti AER61 antibody, anti FLJ13078 antibody, anti FLJ33770 antibody, anti FLJ41219 antibody, anti MGC34132 antibody, anti C3orf64 antibody
Rabbit polyclonal antibody to EOGT
Clonality: Polyclonal
Concentration: 0.5 mg/ml
Molecular Weight: 52kDa
NCBI: 775925
UniProt: Q5NDL2
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Form: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence: Synthetic peptide located within the following region: GHHPTLGEHPKFTNYSFDVEEFMYLVLQAADHVLQHPKWPFKKKHDEL
Target: EOGT
Sample Tissue: Human HepG2 Whole Cell, Antibody Dilution: 3 ug/mL.
Sample Tissue: Human HepG2 Whole Cell, Antibody Dilution: 3 ug/mL.
Sample Tissue: Human HepG2 Whole Cell, Antibody Dilution: 3 ug/mL.
Sample Tissue: Human Jurkat Whole Cell, Antibody Dilution: 1 ug/mL.
WB Suggested Anti-C3orf64 Antibody Titration: 0.2-1 ug/mL, Positive Control: Human brain.