C2orf33 Rabbit Polyclonal Antibody, Unconjugated

Artikelnummer: BYT-ORB325479
Artikelname: C2orf33 Rabbit Polyclonal Antibody, Unconjugated
Artikelnummer: BYT-ORB325479
Hersteller Artikelnummer: orb325479
Alternativnummer: BYT-ORB325479-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Human
Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human C2orf33
Konjugation: Unconjugated
Alternative Synonym: anti DKFZp666J168 antibody, anti GL004 antibody, anti MGC110913 antibody, anti C2orf33 antibody
Rabbit polyclonal antibody to MFF
Klonalität: Polyclonal
Konzentration: Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Molekulargewicht: 38kDa
NCBI: 064579
UniProt: Q9GZY8
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequenz: Synthetic peptide located within the following region: VVDAASLRRQIIKLNRRLQLLEEENKERAKREMVMYSITVAFWLLNSWLW
Target-Kategorie: MFF
Sample Tissue: Human HCT116 Whole Cell, Antibody Dilution: 3 ug/mL.
Sample Tissue: Human HepG2 Whole Cell, Antibody Dilution: 1 ug/mL.
Sample Tissue: Human Jurkat Whole Cell, Antibody Dilution: 3 ug/mL.
Positive control (+): MCF7 (N10), Negative control (-): A549 (N03), Antibody concentration: 1 ug/mL.
WB Suggested Anti-C2orf33 Antibody Titration: 0.2-1 ug/mL, Positive Control: Human Muscle.