C2orf33 Rabbit Polyclonal Antibody, Unconjugated

Catalog Number: BYT-ORB325479
Article Name: C2orf33 Rabbit Polyclonal Antibody, Unconjugated
Biozol Catalog Number: BYT-ORB325479
Supplier Catalog Number: orb325479
Alternative Catalog Number: BYT-ORB325479-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Species Reactivity: Human
Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human C2orf33
Conjugation: Unconjugated
Alternative Names: anti DKFZp666J168 antibody, anti GL004 antibody, anti MGC110913 antibody, anti C2orf33 antibody
Rabbit polyclonal antibody to MFF
Clonality: Polyclonal
Concentration: Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Molecular Weight: 38kDa
NCBI: 064579
UniProt: Q9GZY8
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Form: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence: Synthetic peptide located within the following region: VVDAASLRRQIIKLNRRLQLLEEENKERAKREMVMYSITVAFWLLNSWLW
Target: MFF
Sample Tissue: Human HCT116 Whole Cell, Antibody Dilution: 3 ug/mL.
Sample Tissue: Human HepG2 Whole Cell, Antibody Dilution: 1 ug/mL.
Sample Tissue: Human Jurkat Whole Cell, Antibody Dilution: 3 ug/mL.
Positive control (+): MCF7 (N10), Negative control (-): A549 (N03), Antibody concentration: 1 ug/mL.
WB Suggested Anti-C2orf33 Antibody Titration: 0.2-1 ug/mL, Positive Control: Human Muscle.