C2orf33 Rabbit Polyclonal Antibody, Unconjugated
Catalog Number:
BYT-ORB325479
| Article Name: |
C2orf33 Rabbit Polyclonal Antibody, Unconjugated |
| Biozol Catalog Number: |
BYT-ORB325479 |
| Supplier Catalog Number: |
orb325479 |
| Alternative Catalog Number: |
BYT-ORB325479-100 |
| Manufacturer: |
Biorbyt |
| Host: |
Rabbit |
| Category: |
Antikörper |
| Application: |
WB |
| Species Reactivity: |
Human |
| Immunogen: |
The immunogen is a synthetic peptide directed towards the C terminal region of human C2orf33 |
| Conjugation: |
Unconjugated |
| Alternative Names: |
anti DKFZp666J168 antibody, anti GL004 antibody, anti MGC110913 antibody, anti C2orf33 antibody |
| Rabbit polyclonal antibody to MFF |
| Clonality: |
Polyclonal |
| Concentration: |
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml |
| Molecular Weight: |
38kDa |
| NCBI: |
064579 |
| UniProt: |
Q9GZY8 |
| Buffer: |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Form: |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Sequence: |
Synthetic peptide located within the following region: VVDAASLRRQIIKLNRRLQLLEEENKERAKREMVMYSITVAFWLLNSWLW |
| Target: |
MFF |
|
Sample Tissue: Human HCT116 Whole Cell, Antibody Dilution: 3 ug/mL. |
|
Sample Tissue: Human HepG2 Whole Cell, Antibody Dilution: 1 ug/mL. |
|
Sample Tissue: Human Jurkat Whole Cell, Antibody Dilution: 3 ug/mL. |
|
Positive control (+): MCF7 (N10), Negative control (-): A549 (N03), Antibody concentration: 1 ug/mL. |
|
WB Suggested Anti-C2orf33 Antibody Titration: 0.2-1 ug/mL, Positive Control: Human Muscle. |