SH2D3C Rabbit Polyclonal Antibody, Unconjugated
Artikelnummer:
BYT-ORB325835
- Bilder (5)
| Artikelname: | SH2D3C Rabbit Polyclonal Antibody, Unconjugated |
| Artikelnummer: | BYT-ORB325835 |
| Hersteller Artikelnummer: | orb325835 |
| Alternativnummer: | BYT-ORB325835-100 |
| Hersteller: | Biorbyt |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | WB |
| Spezies Reaktivität: | Human |
| Immunogen: | The immunogen is a synthetic peptide directed towards the N terminal region of human SH2D3C |
| Konjugation: | Unconjugated |
| Alternative Synonym: | anti Chat antibody, anti FLJ39664 antibody, anti NSP3 antibody, anti PRO34088 antibody, anti-SH2D3C antibody |
| Rabbit polyclonal antibody to Chat |
| Klonalität: | Polyclonal |
| Konzentration: | 0.5 mg/ml |
| Molekulargewicht: | 77kDa |
| NCBI: | 733745 |
| UniProt: | Q8N5H7 |
| Puffer: | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Formulierung: | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Sequenz: | Synthetic peptide located within the following region: AGSDYVKFSKEKYILDSSPEKLHKELEEELKLSSTDLRSHAWYHGRIPRE |
| Target-Kategorie: | SH2D3C |
|
|
Sample Type: Human Adult Placenta, Antibody Dilution: 1.0 ug/mL. |
|
|
Sample Type: Human Adult Placenta, Antibody Dilution: 1.0 ug/mL. |
|
|
Sample Type: Human Fetal Lung, Antibody Dilution: 1.0 ug/mL. |
|
|
Sample Type: Human Fetal Muscle, Antibody Dilution: 1.0 ug/mL. |
|
|
WB Suggested Anti-SH2D3C Antibody Titration: 0.2-1 ug/mL, ELISA Titer: 1:1562500, Positive Control: Jurkat cell lysate. |
Produktgarantie und fachkundiger Support
