SH2D3C Rabbit Polyclonal Antibody, Unconjugated
Artikelnummer:
BYT-ORB325835
| Artikelname: |
SH2D3C Rabbit Polyclonal Antibody, Unconjugated |
| Artikelnummer: |
BYT-ORB325835 |
| Hersteller Artikelnummer: |
orb325835 |
| Alternativnummer: |
BYT-ORB325835-100 |
| Hersteller: |
Biorbyt |
| Wirt: |
Rabbit |
| Kategorie: |
Antikörper |
| Applikation: |
WB |
| Spezies Reaktivität: |
Human |
| Immunogen: |
The immunogen is a synthetic peptide directed towards the N terminal region of human SH2D3C |
| Konjugation: |
Unconjugated |
| Alternative Synonym: |
anti Chat antibody, anti FLJ39664 antibody, anti NSP3 antibody, anti PRO34088 antibody, anti-SH2D3C antibody |
| Rabbit polyclonal antibody to Chat |
| Klonalität: |
Polyclonal |
| Konzentration: |
0.5 mg/ml |
| Molekulargewicht: |
77kDa |
| NCBI: |
733745 |
| UniProt: |
Q8N5H7 |
| Puffer: |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Formulierung: |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Sequenz: |
Synthetic peptide located within the following region: AGSDYVKFSKEKYILDSSPEKLHKELEEELKLSSTDLRSHAWYHGRIPRE |
| Target-Kategorie: |
SH2D3C |
|
Sample Type: Human Adult Placenta, Antibody Dilution: 1.0 ug/mL. |
|
Sample Type: Human Adult Placenta, Antibody Dilution: 1.0 ug/mL. |
|
Sample Type: Human Fetal Lung, Antibody Dilution: 1.0 ug/mL. |
|
Sample Type: Human Fetal Muscle, Antibody Dilution: 1.0 ug/mL. |
|
WB Suggested Anti-SH2D3C Antibody Titration: 0.2-1 ug/mL, ELISA Titer: 1:1562500, Positive Control: Jurkat cell lysate. |