SH2D3C Rabbit Polyclonal Antibody, Unconjugated
Catalog Number:
BYT-ORB325835
- Images (5)
| Article Name: | SH2D3C Rabbit Polyclonal Antibody, Unconjugated |
| Biozol Catalog Number: | BYT-ORB325835 |
| Supplier Catalog Number: | orb325835 |
| Alternative Catalog Number: | BYT-ORB325835-100 |
| Manufacturer: | Biorbyt |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | WB |
| Species Reactivity: | Human |
| Immunogen: | The immunogen is a synthetic peptide directed towards the N terminal region of human SH2D3C |
| Conjugation: | Unconjugated |
| Alternative Names: | anti Chat antibody, anti FLJ39664 antibody, anti NSP3 antibody, anti PRO34088 antibody, anti-SH2D3C antibody |
| Rabbit polyclonal antibody to Chat |
| Clonality: | Polyclonal |
| Concentration: | 0.5 mg/ml |
| Molecular Weight: | 77kDa |
| NCBI: | 733745 |
| UniProt: | Q8N5H7 |
| Buffer: | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Form: | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Sequence: | Synthetic peptide located within the following region: AGSDYVKFSKEKYILDSSPEKLHKELEEELKLSSTDLRSHAWYHGRIPRE |
| Target: | SH2D3C |
|
|
Sample Type: Human Adult Placenta, Antibody Dilution: 1.0 ug/mL. |
|
|
Sample Type: Human Adult Placenta, Antibody Dilution: 1.0 ug/mL. |
|
|
Sample Type: Human Fetal Lung, Antibody Dilution: 1.0 ug/mL. |
|
|
Sample Type: Human Fetal Muscle, Antibody Dilution: 1.0 ug/mL. |
|
|
WB Suggested Anti-SH2D3C Antibody Titration: 0.2-1 ug/mL, ELISA Titer: 1:1562500, Positive Control: Jurkat cell lysate. |
Product Guarantee and Expert Support
