SH2D3C Rabbit Polyclonal Antibody, Unconjugated
Catalog Number:
BYT-ORB325835
| Article Name: |
SH2D3C Rabbit Polyclonal Antibody, Unconjugated |
| Biozol Catalog Number: |
BYT-ORB325835 |
| Supplier Catalog Number: |
orb325835 |
| Alternative Catalog Number: |
BYT-ORB325835-100 |
| Manufacturer: |
Biorbyt |
| Host: |
Rabbit |
| Category: |
Antikörper |
| Application: |
WB |
| Species Reactivity: |
Human |
| Immunogen: |
The immunogen is a synthetic peptide directed towards the N terminal region of human SH2D3C |
| Conjugation: |
Unconjugated |
| Alternative Names: |
anti Chat antibody, anti FLJ39664 antibody, anti NSP3 antibody, anti PRO34088 antibody, anti-SH2D3C antibody |
| Rabbit polyclonal antibody to Chat |
| Clonality: |
Polyclonal |
| Concentration: |
0.5 mg/ml |
| Molecular Weight: |
77kDa |
| NCBI: |
733745 |
| UniProt: |
Q8N5H7 |
| Buffer: |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Form: |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Sequence: |
Synthetic peptide located within the following region: AGSDYVKFSKEKYILDSSPEKLHKELEEELKLSSTDLRSHAWYHGRIPRE |
| Target: |
SH2D3C |
|
Sample Type: Human Adult Placenta, Antibody Dilution: 1.0 ug/mL. |
|
Sample Type: Human Adult Placenta, Antibody Dilution: 1.0 ug/mL. |
|
Sample Type: Human Fetal Lung, Antibody Dilution: 1.0 ug/mL. |
|
Sample Type: Human Fetal Muscle, Antibody Dilution: 1.0 ug/mL. |
|
WB Suggested Anti-SH2D3C Antibody Titration: 0.2-1 ug/mL, ELISA Titer: 1:1562500, Positive Control: Jurkat cell lysate. |