NADSYN1 Rabbit Polyclonal Antibody, Unconjugated
Artikelnummer:
BYT-ORB326642
- Bilder (6)
| Artikelname: | NADSYN1 Rabbit Polyclonal Antibody, Unconjugated |
| Artikelnummer: | BYT-ORB326642 |
| Hersteller Artikelnummer: | orb326642 |
| Alternativnummer: | BYT-ORB326642-100 |
| Hersteller: | Biorbyt |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | WB |
| Spezies Reaktivität: | Human |
| Immunogen: | The immunogen is a synthetic peptide directed towards the C-terminal region of Human NADSYN1 |
| Konjugation: | Unconjugated |
| Alternative Synonym: | anti FLJ10631 antibody, anti FLJ36703 antibody, anti FLJ40627 antibody |
| Rabbit polyclonal antibody to NADSYN1 |
| Klonalität: | Polyclonal |
| Konzentration: | 0.5 mg/ml |
| Molekulargewicht: | 78kDa |
| NCBI: | 060631 |
| UniProt: | Q6IA69 |
| Puffer: | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Formulierung: | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Sequenz: | Synthetic peptide located within the following region: PAYHAENYSPEDNRFDLRPFLYNTSWPWQFRCIENQVLQLERAEPQSLDG |
| Target-Kategorie: | NADSYN1 |
|
|
Sample Tissue: Human 786-0 Whole Cell, Antibody Dilution: 1 ug/mL. |
|
|
Sample Tissue: Human HCT116 Whole Cell, Antibody Dilution: 1 ug/mL. |
|
|
Sample Tissue: Human HCT116 Whole Cell, Antibody Dilution: 3 ug/mL. |
|
|
Sample Tissue: Human HT1080 Whole Cell, Antibody Dilution: 1 ug/mL. |
|
|
Sample Type: PANC1 Whole Cell lysates, Antibody Dilution: 1.0 ug/mL. |
|
|
Positive control (+): MCF7 Cell Lysate (N10), Negative control (-): HepG2 Cell Lysate (HG), Antibody concentration: 3 ug/mL. |
Produktgarantie und fachkundiger Support
