NADSYN1 Rabbit Polyclonal Antibody, Unconjugated
Catalog Number:
BYT-ORB326642
- Images (6)
| Article Name: | NADSYN1 Rabbit Polyclonal Antibody, Unconjugated |
| Biozol Catalog Number: | BYT-ORB326642 |
| Supplier Catalog Number: | orb326642 |
| Alternative Catalog Number: | BYT-ORB326642-100 |
| Manufacturer: | Biorbyt |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | WB |
| Species Reactivity: | Human |
| Immunogen: | The immunogen is a synthetic peptide directed towards the C-terminal region of Human NADSYN1 |
| Conjugation: | Unconjugated |
| Alternative Names: | anti FLJ10631 antibody, anti FLJ36703 antibody, anti FLJ40627 antibody |
| Rabbit polyclonal antibody to NADSYN1 |
| Clonality: | Polyclonal |
| Concentration: | 0.5 mg/ml |
| Molecular Weight: | 78kDa |
| NCBI: | 060631 |
| UniProt: | Q6IA69 |
| Buffer: | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Form: | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Sequence: | Synthetic peptide located within the following region: PAYHAENYSPEDNRFDLRPFLYNTSWPWQFRCIENQVLQLERAEPQSLDG |
| Target: | NADSYN1 |
|
|
Sample Tissue: Human 786-0 Whole Cell, Antibody Dilution: 1 ug/mL. |
|
|
Sample Tissue: Human HCT116 Whole Cell, Antibody Dilution: 1 ug/mL. |
|
|
Sample Tissue: Human HCT116 Whole Cell, Antibody Dilution: 3 ug/mL. |
|
|
Sample Tissue: Human HT1080 Whole Cell, Antibody Dilution: 1 ug/mL. |
|
|
Sample Type: PANC1 Whole Cell lysates, Antibody Dilution: 1.0 ug/mL. |
|
|
Positive control (+): MCF7 Cell Lysate (N10), Negative control (-): HepG2 Cell Lysate (HG), Antibody concentration: 3 ug/mL. |
Product Guarantee and Expert Support
