NDUFA13 Rabbit Polyclonal Antibody, Unconjugated
Artikelnummer:
BYT-ORB327376
- Bilder (6)
| Artikelname: | NDUFA13 Rabbit Polyclonal Antibody, Unconjugated |
| Artikelnummer: | BYT-ORB327376 |
| Hersteller Artikelnummer: | orb327376 |
| Alternativnummer: | BYT-ORB327376-100 |
| Hersteller: | Biorbyt |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | WB |
| Spezies Reaktivität: | Human |
| Immunogen: | The immunogen is a synthetic peptide directed towards the N-terminal region of Human NDUAD |
| Konjugation: | Unconjugated |
| Alternative Synonym: | anti NDUFA13 antibody, anti GRIM19 antibody, anti CDA016 antibody, anti CGI-39 antibody, anti antibody |
| Rabbit polyclonal antibody to NDUAD |
| Klonalität: | Polyclonal |
| Konzentration: | 0.5 mg/ml |
| Molekulargewicht: | 15kDa |
| NCBI: | 057049 |
| UniProt: | Q9P0J0 |
| Puffer: | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Formulierung: | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Sequenz: | Synthetic peptide located within the following region: MPPPGGYGPIDYKRNLPRRGLSGYSMLAIGIGTLIYGHWSIMKWNRERRR |
| Target-Kategorie: | NDUFA13 |
|
|
Sample Tissue: Human A549, Antibody Dilution: 1.0 ug/mL. |
|
|
Sample Type: Fetal Kidney lysates, Antibody Dilution: 1.0 ug/mL. |
|
|
Sample Tissue: Human HCT116 Whole Cell, Antibody Dilution: 3 ug/mL. |
|
|
Sample Tissue: Human HepG2 Whole Cell, Antibody Dilution: 1 ug/mL. |
|
|
Sample Tissue: Human HT1080 Whole Cell, Antibody Dilution: 3 ug/mL. |
|
|
Sample Tissue: Human Jurkat Whole Cell, Antibody Dilution: 3 ug/mL. |
Produktgarantie und fachkundiger Support
