NDUFA13 Rabbit Polyclonal Antibody, Unconjugated
Catalog Number:
BYT-ORB327376
- Images (6)
| Article Name: | NDUFA13 Rabbit Polyclonal Antibody, Unconjugated |
| Biozol Catalog Number: | BYT-ORB327376 |
| Supplier Catalog Number: | orb327376 |
| Alternative Catalog Number: | BYT-ORB327376-100 |
| Manufacturer: | Biorbyt |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | WB |
| Species Reactivity: | Human |
| Immunogen: | The immunogen is a synthetic peptide directed towards the N-terminal region of Human NDUAD |
| Conjugation: | Unconjugated |
| Alternative Names: | anti NDUFA13 antibody, anti GRIM19 antibody, anti CDA016 antibody, anti CGI-39 antibody, anti antibody |
| Rabbit polyclonal antibody to NDUAD |
| Clonality: | Polyclonal |
| Concentration: | 0.5 mg/ml |
| Molecular Weight: | 15kDa |
| NCBI: | 057049 |
| UniProt: | Q9P0J0 |
| Buffer: | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Form: | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Sequence: | Synthetic peptide located within the following region: MPPPGGYGPIDYKRNLPRRGLSGYSMLAIGIGTLIYGHWSIMKWNRERRR |
| Target: | NDUFA13 |
|
|
Sample Tissue: Human A549, Antibody Dilution: 1.0 ug/mL. |
|
|
Sample Type: Fetal Kidney lysates, Antibody Dilution: 1.0 ug/mL. |
|
|
Sample Tissue: Human HCT116 Whole Cell, Antibody Dilution: 3 ug/mL. |
|
|
Sample Tissue: Human HepG2 Whole Cell, Antibody Dilution: 1 ug/mL. |
|
|
Sample Tissue: Human HT1080 Whole Cell, Antibody Dilution: 3 ug/mL. |
|
|
Sample Tissue: Human Jurkat Whole Cell, Antibody Dilution: 3 ug/mL. |
Product Guarantee and Expert Support
