ATF5 Rabbit Polyclonal Antibody, Unconjugated
Artikelnummer:
BYT-ORB329589
- Bilder (5)
| Artikelname: | ATF5 Rabbit Polyclonal Antibody, Unconjugated |
| Artikelnummer: | BYT-ORB329589 |
| Hersteller Artikelnummer: | orb329589 |
| Alternativnummer: | BYT-ORB329589-100 |
| Hersteller: | Biorbyt |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | WB |
| Spezies Reaktivität: | Human |
| Immunogen: | The immunogen is a synthetic peptide directed towards the N-terminal region of Human ATF5 |
| Konjugation: | Unconjugated |
| Alternative Synonym: | anti ATFX antibody, anti HMFN0395 antibody |
| Rabbit polyclonal antibody to ATF5 |
| Klonalität: | Polyclonal |
| Konzentration: | 0.5 mg/ml |
| Molekulargewicht: | 31kDa |
| NCBI: | 036200 |
| UniProt: | Q9Y2D1 |
| Puffer: | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Formulierung: | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Sequenz: | Synthetic peptide located within the following region: MASLLKKELEQMEDFFLDAPPLPPPSPPPLPPPPLPPAPSLPLSLPSFDL |
| Target-Kategorie: | ATF5 |
|
|
Sample Tissue: Human Hela, Antibody Dilution: 1.0 ug/mL. |
|
|
Sample Type: Hela Whole Cell lysates, Antibody Dilution: 0.25 ug/mL. |
|
|
Sample Type: Hela Whole Cell lysates, Antibody Dilution: 0.5 ug/mL. |
|
|
Sample Type: Hela Whole Cell lysates, Antibody Dilution: 1.0 ug/mL. |
|
|
Positive control (+): MCF7 (N10), Negative control (-): Ovary tumor (T-OV), Antibody concentration: 2 ug/mL. |
Produktgarantie und fachkundiger Support
