ATF5 Rabbit Polyclonal Antibody, Unconjugated
Catalog Number:
BYT-ORB329589
- Images (5)
| Article Name: | ATF5 Rabbit Polyclonal Antibody, Unconjugated |
| Biozol Catalog Number: | BYT-ORB329589 |
| Supplier Catalog Number: | orb329589 |
| Alternative Catalog Number: | BYT-ORB329589-100 |
| Manufacturer: | Biorbyt |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | WB |
| Species Reactivity: | Human |
| Immunogen: | The immunogen is a synthetic peptide directed towards the N-terminal region of Human ATF5 |
| Conjugation: | Unconjugated |
| Alternative Names: | anti ATFX antibody, anti HMFN0395 antibody |
| Rabbit polyclonal antibody to ATF5 |
| Clonality: | Polyclonal |
| Concentration: | 0.5 mg/ml |
| Molecular Weight: | 31kDa |
| NCBI: | 036200 |
| UniProt: | Q9Y2D1 |
| Buffer: | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Form: | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Sequence: | Synthetic peptide located within the following region: MASLLKKELEQMEDFFLDAPPLPPPSPPPLPPPPLPPAPSLPLSLPSFDL |
| Target: | ATF5 |
|
|
Sample Tissue: Human Hela, Antibody Dilution: 1.0 ug/mL. |
|
|
Sample Type: Hela Whole Cell lysates, Antibody Dilution: 0.25 ug/mL. |
|
|
Sample Type: Hela Whole Cell lysates, Antibody Dilution: 0.5 ug/mL. |
|
|
Sample Type: Hela Whole Cell lysates, Antibody Dilution: 1.0 ug/mL. |
|
|
Positive control (+): MCF7 (N10), Negative control (-): Ovary tumor (T-OV), Antibody concentration: 2 ug/mL. |
Product Guarantee and Expert Support
