EN2 Rabbit Polyclonal Antibody, Unconjugated
Artikelnummer:
BYT-ORB329598
- Bilder (5)
| Artikelname: | EN2 Rabbit Polyclonal Antibody, Unconjugated |
| Artikelnummer: | BYT-ORB329598 |
| Hersteller Artikelnummer: | orb329598 |
| Alternativnummer: | BYT-ORB329598-100 |
| Hersteller: | Biorbyt |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | IHC, WB |
| Spezies Reaktivität: | Human |
| Immunogen: | The immunogen is a synthetic peptide directed towards the C-terminal region of Human EN2 |
| Konjugation: | Unconjugated |
| Rabbit polyclonal antibody to EN2 |
| Klonalität: | Polyclonal |
| Konzentration: | 0.5 mg/ml |
| Molekulargewicht: | 34kDa |
| NCBI: | 001418 |
| UniProt: | P19622 |
| Puffer: | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Formulierung: | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Sequenz: | Synthetic peptide located within the following region: NESQIKIWFQNKRAKIKKATGNKNTLAVHLMAQGLYNHSTTAKEGKSDSE |
| Target-Kategorie: | EN2 |
|
|
Sample Tissue: Human Jurkat, Antibody Dilution: 1.0 ug/mL. |
|
|
Positive control (+): 293T (2T), Negative control (-): Ovary tumor (T-OV), Antibody concentration: 3 ug/mL. |
|
|
Human Kidney |
|
|
Rabbit Anti-EN2 Antibody, Paraffin Embedded Tissue: Human Kidney, Cellular Data: Epithelial cells of renal tubule, Antibody Concentration: 4.0-8.0 ug/mL, Magnification: 400X. |
|
|
WB Suggested Anti-EN2 Antibody Titration: 0.05 ug/mL, ELISA Titer: 1:2500, Positive Control: Human cerebellum. |
Produktgarantie und fachkundiger Support
