EN2 Rabbit Polyclonal Antibody, Unconjugated
Catalog Number:
BYT-ORB329598
- Images (5)
| Article Name: | EN2 Rabbit Polyclonal Antibody, Unconjugated |
| Biozol Catalog Number: | BYT-ORB329598 |
| Supplier Catalog Number: | orb329598 |
| Alternative Catalog Number: | BYT-ORB329598-100 |
| Manufacturer: | Biorbyt |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | IHC, WB |
| Species Reactivity: | Human |
| Immunogen: | The immunogen is a synthetic peptide directed towards the C-terminal region of Human EN2 |
| Conjugation: | Unconjugated |
| Rabbit polyclonal antibody to EN2 |
| Clonality: | Polyclonal |
| Concentration: | 0.5 mg/ml |
| Molecular Weight: | 34kDa |
| NCBI: | 001418 |
| UniProt: | P19622 |
| Buffer: | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Form: | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Sequence: | Synthetic peptide located within the following region: NESQIKIWFQNKRAKIKKATGNKNTLAVHLMAQGLYNHSTTAKEGKSDSE |
| Target: | EN2 |
|
|
Sample Tissue: Human Jurkat, Antibody Dilution: 1.0 ug/mL. |
|
|
Positive control (+): 293T (2T), Negative control (-): Ovary tumor (T-OV), Antibody concentration: 3 ug/mL. |
|
|
Human Kidney |
|
|
Rabbit Anti-EN2 Antibody, Paraffin Embedded Tissue: Human Kidney, Cellular Data: Epithelial cells of renal tubule, Antibody Concentration: 4.0-8.0 ug/mL, Magnification: 400X. |
|
|
WB Suggested Anti-EN2 Antibody Titration: 0.05 ug/mL, ELISA Titer: 1:2500, Positive Control: Human cerebellum. |
Product Guarantee and Expert Support
