PDK1 Rabbit Polyclonal Antibody, Unconjugated
Artikelnummer:
BYT-ORB329620
- Bilder (5)
| Artikelname: | PDK1 Rabbit Polyclonal Antibody, Unconjugated |
| Artikelnummer: | BYT-ORB329620 |
| Hersteller Artikelnummer: | orb329620 |
| Alternativnummer: | BYT-ORB329620-100 |
| Hersteller: | Biorbyt |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | WB |
| Spezies Reaktivität: | Human, Mouse |
| Immunogen: | The immunogen is a synthetic peptide directed towards the middle region of human PDK1 |
| Konjugation: | Unconjugated |
| Rabbit polyclonal antibody to PDK1 |
| Klonalität: | Polyclonal |
| Konzentration: | 0.5 mg/ml |
| Molekulargewicht: | 47kDa |
| NCBI: | 002601 |
| UniProt: | Q15118 |
| Puffer: | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Formulierung: | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Sequenz: | Synthetic peptide located within the following region: ATMEHHANRGVYPPIQVHVTLGNEDLTVKMSDRGGGVPLRKIDRLFNYMY |
| Target-Kategorie: | PDK1 |
|
|
Sample Tissue: Mouse Testis, Antibody Dilution: 1 ug/mL. |
|
|
Sample Type: Human Adult Placenta, Antibody Dilution: 1.0 ug/mL. |
|
|
Sample Tissue: Mouse Testis, Antibody Dilution: 1 ug/mL. |
|
|
Sample Type: Human Jurkat, Antibody Dilution: 1.0 ug/mL, PDK1 is supported by BioGPS gene expression data to be expressed in Jurkat. |
|
|
WB Suggested Anti-PDK1 Antibody Titration: 0.2-1 ug/mL, ELISA Titer: 1:1562500, Positive Control: MCF7 cell lysate. |
Produktgarantie und fachkundiger Support
