PDK1 Rabbit Polyclonal Antibody, Unconjugated
Catalog Number:
BYT-ORB329620
- Images (5)
| Article Name: | PDK1 Rabbit Polyclonal Antibody, Unconjugated |
| Biozol Catalog Number: | BYT-ORB329620 |
| Supplier Catalog Number: | orb329620 |
| Alternative Catalog Number: | BYT-ORB329620-100 |
| Manufacturer: | Biorbyt |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | WB |
| Species Reactivity: | Human, Mouse |
| Immunogen: | The immunogen is a synthetic peptide directed towards the middle region of human PDK1 |
| Conjugation: | Unconjugated |
| Rabbit polyclonal antibody to PDK1 |
| Clonality: | Polyclonal |
| Concentration: | 0.5 mg/ml |
| Molecular Weight: | 47kDa |
| NCBI: | 002601 |
| UniProt: | Q15118 |
| Buffer: | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Form: | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Sequence: | Synthetic peptide located within the following region: ATMEHHANRGVYPPIQVHVTLGNEDLTVKMSDRGGGVPLRKIDRLFNYMY |
| Target: | PDK1 |
|
|
Sample Tissue: Mouse Testis, Antibody Dilution: 1 ug/mL. |
|
|
Sample Type: Human Adult Placenta, Antibody Dilution: 1.0 ug/mL. |
|
|
Sample Tissue: Mouse Testis, Antibody Dilution: 1 ug/mL. |
|
|
Sample Type: Human Jurkat, Antibody Dilution: 1.0 ug/mL, PDK1 is supported by BioGPS gene expression data to be expressed in Jurkat. |
|
|
WB Suggested Anti-PDK1 Antibody Titration: 0.2-1 ug/mL, ELISA Titer: 1:1562500, Positive Control: MCF7 cell lysate. |
Product Guarantee and Expert Support
