Warenkorb

Produktsuche

Home
Produkte
POU2F3 Rabbit Polyclonal Antibody, Unconjugated

POU2F3 Rabbit Polyclonal Antibody, Unconjugated

Artikelnummer: BYT-ORB329669

Bilder (6)
Sehen Sie alle Bilder und Bildinformationen

Artikelname:	POU2F3 Rabbit Polyclonal Antibody, Unconjugated
Artikelnummer:	BYT-ORB329669
Hersteller Artikelnummer:	orb329669
Alternativnummer:	BYT-ORB329669-100
Hersteller:	Biorbyt
Wirt:	Rabbit
Kategorie:	Antikörper
Applikation:	IHC, WB
Spezies Reaktivität:	Human, Mouse, Rat
Immunogen:	The immunogen is a synthetic peptide directed towards the N terminal region of human POU2F3
Konjugation:	Unconjugated
Alternative Synonym:	anti PLA1 antibody, anti OCT11 antibody, anti PLA-1 antibody, anti Epoc-1 antibody, anti OCT-11 antibody, anti OTF-11 antibody, anti Skn-1a antibody

Rabbit polyclonal antibody to POU2F3

Klonalität:	Polyclonal
Konzentration:	0.5 mg/ml
Molekulargewicht:	47 kDa
NCBI:	055167
UniProt:	Q9UKI9
Puffer:	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Formulierung:	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequenz:	Synthetic peptide located within the following region: KMSGDVADSTDARSTLSQVEPGNDRKGLDFNRQIKTEDLSDSLQQTLSHR
Target-Kategorie:	POU2F3

	25 ug of the indicated whole cell extracts was loaded onto a 12% SDS-PAGE gel. 0.5 ug/mL of the antibody was used in this experiment. N-terminal peptide also overlaps with isoform 3 at 39 kDa in some samples.
	Sample Tissue: Rat Brain, Antibody Dilution: 1 ug/mL.
	Human Muscle
	Rabbit Anti-POU2F3 antibody, Formalin Fixed Paraffin Embedded Tissue: Human Skin, Primary antibody Concentration: 1:200, Secondary Antibody: Donkey anti-Rabbit-Cy3, Secondary Antibody Concentration: 1:200, Magnification: 20x, Exposure Time: 0.5-2.0 sec.
	Sample Type: Mouse tongue tissue, Primary Antibody Dilution: 1:100, Secondary Antibody: Anti-rabbit-Cy3, Secondary Antibody Dilution: 1:500, Color/Signal Descriptions: Red: POU2F3, Gene Name: POU2F3.
	WB Suggested Anti-POU2F3 Antibody Titration: 0.2-1 ug/mL, ELISA Titer: 1:312500, Positive Control: HepG2 cell lysate.

* Mehrwertsteuer und Versandkosten nicht enthalten.
Irrtümer und Preisänderungen vorbehalten