POU2F3 Rabbit Polyclonal Antibody, Unconjugated

Catalog Number: BYT-ORB329669
Article Name: POU2F3 Rabbit Polyclonal Antibody, Unconjugated
Biozol Catalog Number: BYT-ORB329669
Supplier Catalog Number: orb329669
Alternative Catalog Number: BYT-ORB329669-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: IHC, WB
Species Reactivity: Human, Mouse, Rat
Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human POU2F3
Conjugation: Unconjugated
Alternative Names: anti PLA1 antibody, anti OCT11 antibody, anti PLA-1 antibody, anti Epoc-1 antibody, anti OCT-11 antibody, anti OTF-11 antibody, anti Skn-1a antibody
Rabbit polyclonal antibody to POU2F3
Clonality: Polyclonal
Concentration: 0.5 mg/ml
Molecular Weight: 47 kDa
NCBI: 055167
UniProt: Q9UKI9
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Form: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence: Synthetic peptide located within the following region: KMSGDVADSTDARSTLSQVEPGNDRKGLDFNRQIKTEDLSDSLQQTLSHR
Target: POU2F3
25 ug of the indicated whole cell extracts was loaded onto a 12% SDS-PAGE gel. 0.5 ug/mL of the antibody was used in this experiment. N-terminal peptide also overlaps with isoform 3 at 39 kDa in some samples.
Sample Tissue: Rat Brain, Antibody Dilution: 1 ug/mL.
Human Muscle
Rabbit Anti-POU2F3 antibody, Formalin Fixed Paraffin Embedded Tissue: Human Skin, Primary antibody Concentration: 1:200, Secondary Antibody: Donkey anti-Rabbit-Cy3, Secondary Antibody Concentration: 1:200, Magnification: 20x, Exposure Time: 0.5-2.0 sec.
Sample Type: Mouse tongue tissue, Primary Antibody Dilution: 1:100, Secondary Antibody: Anti-rabbit-Cy3, Secondary Antibody Dilution: 1:500, Color/Signal Descriptions: Red: POU2F3, Gene Name: POU2F3.
WB Suggested Anti-POU2F3 Antibody Titration: 0.2-1 ug/mL, ELISA Titer: 1:312500, Positive Control: HepG2 cell lysate.
577,00 €
100 ul
* VAT and and shipping costs not included.
Errors and price changes excepted
Availability
ORDER BY EMAIL
Product Guarantee and Expert Support
BIOZOL