RXRA Rabbit Polyclonal Antibody, Unconjugated
Artikelnummer:
BYT-ORB329759
- Bilder (6)
| Artikelname: | RXRA Rabbit Polyclonal Antibody, Unconjugated |
| Artikelnummer: | BYT-ORB329759 |
| Hersteller Artikelnummer: | orb329759 |
| Alternativnummer: | BYT-ORB329759-100 |
| Hersteller: | Biorbyt |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | WB |
| Spezies Reaktivität: | Human, Rat |
| Immunogen: | The immunogen is a synthetic peptide directed towards the N terminal region of human RXRA |
| Konjugation: | Unconjugated |
| Alternative Synonym: | anti FLJ16020 antibody, anti FLJ16733 antibody, anti MGC102720 antibody, anti NR2B1 antibody |
| Rabbit polyclonal antibody to RXRA |
| Klonalität: | Polyclonal |
| Konzentration: | 0.5 mg/ml |
| Molekulargewicht: | 51kDa |
| NCBI: | 002948 |
| UniProt: | P19793 |
| Puffer: | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Formulierung: | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Sequenz: | Synthetic peptide located within the following region: GPGIGSPGQLHSPISTLSSPINGMGPPFSVISSPMGPHSMSVPTTPTLGF |
| Target-Kategorie: | RXRA |
|
|
Sample Type: Human Adult Placenta, Antibody Dilution: 1.0 ug/mL. |
|
|
Sample Type: Human Fetal Heart, Antibody Dilution: 1.0 ug/mL. |
|
|
Sample Type: Human Fetal Liver, Antibody Dilution: 1.0 ug/mL. |
|
|
Sample Type: Human Fetal Lung, Antibody Dilution: 1.0 ug/mL. |
|
|
Sample Tissue: Rat Skeletal Muscle, Antibody Dilution: 1 ug/mL. |
|
|
WB Suggested Anti-RXRA Antibody Titration: 0.2-1 ug/mL, ELISA Titer: 1:312500, Positive Control: Transfected 293T. |
Produktgarantie und fachkundiger Support
