RXRA Rabbit Polyclonal Antibody, Unconjugated
Catalog Number:
BYT-ORB329759
- Images (6)
| Article Name: | RXRA Rabbit Polyclonal Antibody, Unconjugated |
| Biozol Catalog Number: | BYT-ORB329759 |
| Supplier Catalog Number: | orb329759 |
| Alternative Catalog Number: | BYT-ORB329759-100 |
| Manufacturer: | Biorbyt |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | WB |
| Species Reactivity: | Human, Rat |
| Immunogen: | The immunogen is a synthetic peptide directed towards the N terminal region of human RXRA |
| Conjugation: | Unconjugated |
| Alternative Names: | anti FLJ16020 antibody, anti FLJ16733 antibody, anti MGC102720 antibody, anti NR2B1 antibody |
| Rabbit polyclonal antibody to RXRA |
| Clonality: | Polyclonal |
| Concentration: | 0.5 mg/ml |
| Molecular Weight: | 51kDa |
| NCBI: | 002948 |
| UniProt: | P19793 |
| Buffer: | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Form: | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Sequence: | Synthetic peptide located within the following region: GPGIGSPGQLHSPISTLSSPINGMGPPFSVISSPMGPHSMSVPTTPTLGF |
| Target: | RXRA |
|
|
Sample Type: Human Adult Placenta, Antibody Dilution: 1.0 ug/mL. |
|
|
Sample Type: Human Fetal Heart, Antibody Dilution: 1.0 ug/mL. |
|
|
Sample Type: Human Fetal Liver, Antibody Dilution: 1.0 ug/mL. |
|
|
Sample Type: Human Fetal Lung, Antibody Dilution: 1.0 ug/mL. |
|
|
Sample Tissue: Rat Skeletal Muscle, Antibody Dilution: 1 ug/mL. |
|
|
WB Suggested Anti-RXRA Antibody Titration: 0.2-1 ug/mL, ELISA Titer: 1:312500, Positive Control: Transfected 293T. |
Product Guarantee and Expert Support
