RXRA Rabbit Polyclonal Antibody, Unconjugated

Catalog Number: BYT-ORB329759
Article Name: RXRA Rabbit Polyclonal Antibody, Unconjugated
Biozol Catalog Number: BYT-ORB329759
Supplier Catalog Number: orb329759
Alternative Catalog Number: BYT-ORB329759-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Species Reactivity: Human, Rat
Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human RXRA
Conjugation: Unconjugated
Alternative Names: anti FLJ16020 antibody, anti FLJ16733 antibody, anti MGC102720 antibody, anti NR2B1 antibody
Rabbit polyclonal antibody to RXRA
Clonality: Polyclonal
Concentration: 0.5 mg/ml
Molecular Weight: 51kDa
NCBI: 002948
UniProt: P19793
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Form: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence: Synthetic peptide located within the following region: GPGIGSPGQLHSPISTLSSPINGMGPPFSVISSPMGPHSMSVPTTPTLGF
Target: RXRA
Sample Type: Human Adult Placenta, Antibody Dilution: 1.0 ug/mL.
Sample Type: Human Fetal Heart, Antibody Dilution: 1.0 ug/mL.
Sample Type: Human Fetal Liver, Antibody Dilution: 1.0 ug/mL.
Sample Type: Human Fetal Lung, Antibody Dilution: 1.0 ug/mL.
Sample Tissue: Rat Skeletal Muscle, Antibody Dilution: 1 ug/mL.
WB Suggested Anti-RXRA Antibody Titration: 0.2-1 ug/mL, ELISA Titer: 1:312500, Positive Control: Transfected 293T.