ZYX Rabbit Polyclonal Antibody, Unconjugated
Artikelnummer:
BYT-ORB329778
| Artikelname: |
ZYX Rabbit Polyclonal Antibody, Unconjugated |
| Artikelnummer: |
BYT-ORB329778 |
| Hersteller Artikelnummer: |
orb329778 |
| Alternativnummer: |
BYT-ORB329778-100 |
| Hersteller: |
Biorbyt |
| Wirt: |
Rabbit |
| Kategorie: |
Antikörper |
| Applikation: |
IHC, WB |
| Spezies Reaktivität: |
Human |
| Immunogen: |
The immunogen is a synthetic peptide directed towards the middle region of human ZYX |
| Konjugation: |
Unconjugated |
| Alternative Synonym: |
anti ESP-2 antibody, anti HED-2 antibody |
| Rabbit polyclonal antibody to ZYX |
| Klonalität: |
Polyclonal |
| Konzentration: |
0.5 mg/ml |
| Molekulargewicht: |
61kDa |
| NCBI: |
003452 |
| UniProt: |
Q15942 |
| Puffer: |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Formulierung: |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Sequenz: |
Synthetic peptide located within the following region: QPRGPPASSPAPAPKFSPVTPKFTPVASKFSPGAPGGSGSQPNQKLGHPE |
| Target-Kategorie: |
ZYX |
![]()
|
Rabbit Anti-ZYX Antibody, Catalog Number: orb329778, Formalin Fixed Paraffin Embedded Tissue: Human Adult heart, Observed Staining: Cytoplasmic (cytoskeleton), Primary Antibody Concentration: 1:600, Secondary Antibody: Donkey anti-Rabbit-Cy2/3, Secondary Antibody Concentration: 1:200, Magnification: 20X, Exposure Time: 0.5 - 2.0 sec, Protocol located in Reviews and Data. |
![]()
|
Rabbit Anti-ZYX Antibody, Catalog Number: orb329778, Formalin Fixed Paraffin Embedded Tissue: Human Adult liver, Observed Staining: Cytoplasmic, Primary Antibody Concentration: 1:600, Secondary Antibody: Donkey anti-Rabbit-Cy2/3, Secondary Antibody Concentration: 1:200, Magnification: 20X, Exposure Time: 0.5 - 2.0 sec, Protocol located in Reviews and Data. |
![]()
|
Rabbit Anti-ZYX Antibody, Catalog Number: orb329778, Formalin Fixed Paraffin Embedded Tissue: Human heart Tissue, Observed Staining: Cytoplasmic in mitochondria, Primary Antibody Concentration: N/A, Other Working Concentrations: 1:600, Secondary Antibody: Donkey anti-Rabbit-Cy3, Secondary Antibody Concentration: 1:200, Magnification: 20X, Exposure Time: 0.5 - 2.0 sec. |
![]()
|
WB Suggested Anti-ZYX Antibody Titration: 0.2-1 ug/mL, ELISA Titer: 1:12500, Positive Control: Human Stomach. |
![]()
|
WB Suggested Anti-ZYX antibody Titration: 1 ug/mL, Sample Type: Human heart. |
