ZYX Rabbit Polyclonal Antibody, Unconjugated
Catalog Number:
BYT-ORB329778
| Article Name: |
ZYX Rabbit Polyclonal Antibody, Unconjugated |
| Biozol Catalog Number: |
BYT-ORB329778 |
| Supplier Catalog Number: |
orb329778 |
| Alternative Catalog Number: |
BYT-ORB329778-100 |
| Manufacturer: |
Biorbyt |
| Host: |
Rabbit |
| Category: |
Antikörper |
| Application: |
IHC, WB |
| Species Reactivity: |
Human |
| Immunogen: |
The immunogen is a synthetic peptide directed towards the middle region of human ZYX |
| Conjugation: |
Unconjugated |
| Alternative Names: |
anti ESP-2 antibody, anti HED-2 antibody |
| Rabbit polyclonal antibody to ZYX |
| Clonality: |
Polyclonal |
| Concentration: |
0.5 mg/ml |
| Molecular Weight: |
61kDa |
| NCBI: |
003452 |
| UniProt: |
Q15942 |
| Buffer: |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Form: |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Sequence: |
Synthetic peptide located within the following region: QPRGPPASSPAPAPKFSPVTPKFTPVASKFSPGAPGGSGSQPNQKLGHPE |
| Target: |
ZYX |
![]()
|
Rabbit Anti-ZYX Antibody, Catalog Number: orb329778, Formalin Fixed Paraffin Embedded Tissue: Human Adult heart, Observed Staining: Cytoplasmic (cytoskeleton), Primary Antibody Concentration: 1:600, Secondary Antibody: Donkey anti-Rabbit-Cy2/3, Secondary Antibody Concentration: 1:200, Magnification: 20X, Exposure Time: 0.5 - 2.0 sec, Protocol located in Reviews and Data. |
![]()
|
Rabbit Anti-ZYX Antibody, Catalog Number: orb329778, Formalin Fixed Paraffin Embedded Tissue: Human Adult liver, Observed Staining: Cytoplasmic, Primary Antibody Concentration: 1:600, Secondary Antibody: Donkey anti-Rabbit-Cy2/3, Secondary Antibody Concentration: 1:200, Magnification: 20X, Exposure Time: 0.5 - 2.0 sec, Protocol located in Reviews and Data. |
![]()
|
Rabbit Anti-ZYX Antibody, Catalog Number: orb329778, Formalin Fixed Paraffin Embedded Tissue: Human heart Tissue, Observed Staining: Cytoplasmic in mitochondria, Primary Antibody Concentration: N/A, Other Working Concentrations: 1:600, Secondary Antibody: Donkey anti-Rabbit-Cy3, Secondary Antibody Concentration: 1:200, Magnification: 20X, Exposure Time: 0.5 - 2.0 sec. |
![]()
|
WB Suggested Anti-ZYX Antibody Titration: 0.2-1 ug/mL, ELISA Titer: 1:12500, Positive Control: Human Stomach. |
![]()
|
WB Suggested Anti-ZYX antibody Titration: 1 ug/mL, Sample Type: Human heart. |
