TRPC4 Rabbit Polyclonal Antibody, Unconjugated
Artikelnummer:
BYT-ORB329823
- Bilder (6)
| Artikelname: | TRPC4 Rabbit Polyclonal Antibody, Unconjugated |
| Artikelnummer: | BYT-ORB329823 |
| Hersteller Artikelnummer: | orb329823 |
| Alternativnummer: | BYT-ORB329823-100 |
| Hersteller: | Biorbyt |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | IHC, WB |
| Spezies Reaktivität: | Human |
| Immunogen: | The immunogen is a synthetic peptide directed towards the middle region of human TRPC4 |
| Konjugation: | Unconjugated |
| Alternative Synonym: | anti HTRP4 antibody, anti MGC119570 antibody, anti MGC119571 antibody, anti MGC119572 antibody, anti MGC119573 antibody, anti TRP4 antibody, anti HTRP-4 antibody |
| Rabbit polyclonal antibody to TRPC4 |
| Klonalität: | Polyclonal |
| Konzentration: | 0.5 mg/ml |
| Molekulargewicht: | 112kDa |
| NCBI: | 057263 |
| UniProt: | Q9UBN4 |
| Puffer: | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Formulierung: | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Sequenz: | Synthetic peptide located within the following region: CPFKSEKVVVEDTVPIIPKEKHAKEEDSSIDYDLNLPDTVTHEDYVTTRL |
| Target-Kategorie: | TRPC4 |
|
|
Sample Tissue: Human 293T, Antibody Dilution: 1.0 ug/mL. |
|
|
Sample Type: HepG2, Antibody Dilution: 1.0 ug/mL. |
|
|
Sample Type: MCF7, Antibody Dilution: 1.0 ug/mL. |
|
|
Positive control (+): Mouse pancreas (M-PA), Negative control (-): Human intestine (IN), Antibody concentration: 1 ug/mL. |
|
|
Immunohistochemistry with Placenta tissue at an antibody concentration of 5 ug/mL using anti-TRPC4 antibody (orb329823). |
|
|
WB Suggested Anti-TRPC4 Antibody Titration: 0.2-1 ug/mL, ELISA Titer: 1:312500, Positive Control: 293T cell lysate. |
Produktgarantie und fachkundiger Support
