TRPC4 Rabbit Polyclonal Antibody, Unconjugated
Catalog Number:
BYT-ORB329823
- Images (6)
| Article Name: | TRPC4 Rabbit Polyclonal Antibody, Unconjugated |
| Biozol Catalog Number: | BYT-ORB329823 |
| Supplier Catalog Number: | orb329823 |
| Alternative Catalog Number: | BYT-ORB329823-100 |
| Manufacturer: | Biorbyt |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | IHC, WB |
| Species Reactivity: | Human |
| Immunogen: | The immunogen is a synthetic peptide directed towards the middle region of human TRPC4 |
| Conjugation: | Unconjugated |
| Alternative Names: | anti HTRP4 antibody, anti MGC119570 antibody, anti MGC119571 antibody, anti MGC119572 antibody, anti MGC119573 antibody, anti TRP4 antibody, anti HTRP-4 antibody |
| Rabbit polyclonal antibody to TRPC4 |
| Clonality: | Polyclonal |
| Concentration: | 0.5 mg/ml |
| Molecular Weight: | 112kDa |
| NCBI: | 057263 |
| UniProt: | Q9UBN4 |
| Buffer: | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Form: | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Sequence: | Synthetic peptide located within the following region: CPFKSEKVVVEDTVPIIPKEKHAKEEDSSIDYDLNLPDTVTHEDYVTTRL |
| Target: | TRPC4 |
|
|
Sample Tissue: Human 293T, Antibody Dilution: 1.0 ug/mL. |
|
|
Sample Type: HepG2, Antibody Dilution: 1.0 ug/mL. |
|
|
Sample Type: MCF7, Antibody Dilution: 1.0 ug/mL. |
|
|
Positive control (+): Mouse pancreas (M-PA), Negative control (-): Human intestine (IN), Antibody concentration: 1 ug/mL. |
|
|
Immunohistochemistry with Placenta tissue at an antibody concentration of 5 ug/mL using anti-TRPC4 antibody (orb329823). |
|
|
WB Suggested Anti-TRPC4 Antibody Titration: 0.2-1 ug/mL, ELISA Titer: 1:312500, Positive Control: 293T cell lysate. |
Product Guarantee and Expert Support
