KCNN2 Rabbit Polyclonal Antibody, Unconjugated
Artikelnummer:
BYT-ORB329833
- Bilder (6)
| Artikelname: | KCNN2 Rabbit Polyclonal Antibody, Unconjugated |
| Artikelnummer: | BYT-ORB329833 |
| Hersteller Artikelnummer: | orb329833 |
| Alternativnummer: | BYT-ORB329833-100 |
| Hersteller: | Biorbyt |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | IHC, WB |
| Spezies Reaktivität: | Human, Monkey |
| Immunogen: | The immunogen is a synthetic peptide directed towards the middle region of human KCNN2 |
| Konjugation: | Unconjugated |
| Alternative Synonym: | anti KCa2.2 antibody, anti SK2 antibody, anti SKCA2 antibody, anti hSK2 antibody |
| Rabbit polyclonal antibody to KCNN2 |
| Klonalität: | Polyclonal |
| Konzentration: | 0.5 mg/ml |
| Molekulargewicht: | 26kDa |
| NCBI: | 740721 |
| UniProt: | Q6PJI0 |
| Puffer: | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Formulierung: | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Sequenz: | Synthetic peptide located within the following region: KNAAANVLRETWLIYKNTKLVKKIDHAKVRKHQRKFLQAIHQLRSVKMEQ |
| Target-Kategorie: | KCNN2 |
|
|
Sample Type: Human Fetal Heart, Antibody Dilution: 1.0 ug/mL. |
|
|
Sample Type: Human Fetal Lung, Antibody Dilution: 1.0 ug/mL. |
|
|
Sample Type: Human Fetal Muscle, Antibody Dilution: 1.0 ug/mL. |
|
|
Positive control (+): Human liver (LI), Negative control (-): HeLa (HL), Antibody concentration: 1 ug/mL. |
|
|
Sample Type: Rhesus macaque spinal cord, Primary Antibody Dilution: 1:300, Secondary Antibody: Donkey anti Rabbit 488, Secondary Antibody Dilution: 1:500, Color/Signal Descriptions: Green: KCNN2, Gene Name: KCNN2. |
|
|
WB Suggested Anti-KCNN2 Antibody Titration: 0.2-1 ug/mL, ELISA Titer: 1:62500, Positive Control: Human Muscle. |
Produktgarantie und fachkundiger Support
