KCNN2 Rabbit Polyclonal Antibody, Unconjugated
Catalog Number:
BYT-ORB329833
- Images (6)
| Article Name: | KCNN2 Rabbit Polyclonal Antibody, Unconjugated |
| Biozol Catalog Number: | BYT-ORB329833 |
| Supplier Catalog Number: | orb329833 |
| Alternative Catalog Number: | BYT-ORB329833-100 |
| Manufacturer: | Biorbyt |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | IHC, WB |
| Species Reactivity: | Human, Monkey |
| Immunogen: | The immunogen is a synthetic peptide directed towards the middle region of human KCNN2 |
| Conjugation: | Unconjugated |
| Alternative Names: | anti KCa2.2 antibody, anti SK2 antibody, anti SKCA2 antibody, anti hSK2 antibody |
| Rabbit polyclonal antibody to KCNN2 |
| Clonality: | Polyclonal |
| Concentration: | 0.5 mg/ml |
| Molecular Weight: | 26kDa |
| NCBI: | 740721 |
| UniProt: | Q6PJI0 |
| Buffer: | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Form: | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Sequence: | Synthetic peptide located within the following region: KNAAANVLRETWLIYKNTKLVKKIDHAKVRKHQRKFLQAIHQLRSVKMEQ |
| Target: | KCNN2 |
|
|
Sample Type: Human Fetal Heart, Antibody Dilution: 1.0 ug/mL. |
|
|
Sample Type: Human Fetal Lung, Antibody Dilution: 1.0 ug/mL. |
|
|
Sample Type: Human Fetal Muscle, Antibody Dilution: 1.0 ug/mL. |
|
|
Positive control (+): Human liver (LI), Negative control (-): HeLa (HL), Antibody concentration: 1 ug/mL. |
|
|
Sample Type: Rhesus macaque spinal cord, Primary Antibody Dilution: 1:300, Secondary Antibody: Donkey anti Rabbit 488, Secondary Antibody Dilution: 1:500, Color/Signal Descriptions: Green: KCNN2, Gene Name: KCNN2. |
|
|
WB Suggested Anti-KCNN2 Antibody Titration: 0.2-1 ug/mL, ELISA Titer: 1:62500, Positive Control: Human Muscle. |
Product Guarantee and Expert Support
