VDR Rabbit Polyclonal Antibody, Unconjugated

Artikelnummer: BYT-ORB329948
Artikelname: VDR Rabbit Polyclonal Antibody, Unconjugated
Artikelnummer: BYT-ORB329948
Hersteller Artikelnummer: orb329948
Alternativnummer: BYT-ORB329948-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Human
Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human VDR
Konjugation: Unconjugated
Alternative Synonym: anti NR1I1 antibody
Rabbit polyclonal antibody to VDR
Klonalität: Polyclonal
Konzentration: 0.5 mg/ml
Molekulargewicht: 48kDa
NCBI: 000367
UniProt: P11473
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequenz: Synthetic peptide located within the following region: EAMAASTSLPDPGDFDRNVPRICGVCGDRATGFHFNAMTCEGCKGFFRRS
Target-Kategorie: VDR
Sample Type: Human Adult Placenta, Antibody Dilution: 1.0 ug/mL.
Sample Type: Human Fetal Heart, Antibody Dilution: 1.0 ug/mL.
Sample Type: Human Fetal Liver, Antibody Dilution: 1.0 ug/mL.
Sample Type: Human Fetal Muscle, Antibody Dilution: 1.0 ug/mL.
WB Suggested Anti-VDR Antibody Titration: 0.2-1 ug/mL, ELISA Titer: 1:1562500, Positive Control: Human brain.