VDR Rabbit Polyclonal Antibody, Unconjugated
Artikelnummer:
BYT-ORB329948
- Bilder (5)
| Artikelname: | VDR Rabbit Polyclonal Antibody, Unconjugated |
| Artikelnummer: | BYT-ORB329948 |
| Hersteller Artikelnummer: | orb329948 |
| Alternativnummer: | BYT-ORB329948-100 |
| Hersteller: | Biorbyt |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | WB |
| Spezies Reaktivität: | Human |
| Immunogen: | The immunogen is a synthetic peptide directed towards the N terminal region of human VDR |
| Konjugation: | Unconjugated |
| Alternative Synonym: | anti NR1I1 antibody |
| Rabbit polyclonal antibody to VDR |
| Klonalität: | Polyclonal |
| Konzentration: | 0.5 mg/ml |
| Molekulargewicht: | 48kDa |
| NCBI: | 000367 |
| UniProt: | P11473 |
| Puffer: | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Formulierung: | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Sequenz: | Synthetic peptide located within the following region: EAMAASTSLPDPGDFDRNVPRICGVCGDRATGFHFNAMTCEGCKGFFRRS |
| Target-Kategorie: | VDR |





