VDR Rabbit Polyclonal Antibody, Unconjugated
Catalog Number:
BYT-ORB329948
- Images (5)
| Article Name: | VDR Rabbit Polyclonal Antibody, Unconjugated |
| Biozol Catalog Number: | BYT-ORB329948 |
| Supplier Catalog Number: | orb329948 |
| Alternative Catalog Number: | BYT-ORB329948-100 |
| Manufacturer: | Biorbyt |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | WB |
| Species Reactivity: | Human |
| Immunogen: | The immunogen is a synthetic peptide directed towards the N terminal region of human VDR |
| Conjugation: | Unconjugated |
| Alternative Names: | anti NR1I1 antibody |
| Rabbit polyclonal antibody to VDR |
| Clonality: | Polyclonal |
| Concentration: | 0.5 mg/ml |
| Molecular Weight: | 48kDa |
| NCBI: | 000367 |
| UniProt: | P11473 |
| Buffer: | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Form: | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Sequence: | Synthetic peptide located within the following region: EAMAASTSLPDPGDFDRNVPRICGVCGDRATGFHFNAMTCEGCKGFFRRS |
| Target: | VDR |
|
|
Sample Type: Human Adult Placenta, Antibody Dilution: 1.0 ug/mL. |
|
|
Sample Type: Human Fetal Heart, Antibody Dilution: 1.0 ug/mL. |
|
|
Sample Type: Human Fetal Liver, Antibody Dilution: 1.0 ug/mL. |
|
|
Sample Type: Human Fetal Muscle, Antibody Dilution: 1.0 ug/mL. |
|
|
WB Suggested Anti-VDR Antibody Titration: 0.2-1 ug/mL, ELISA Titer: 1:1562500, Positive Control: Human brain. |
Product Guarantee and Expert Support
