IGF2BP1 Rabbit Polyclonal Antibody, Unconjugated

Artikelnummer: BYT-ORB330140
Artikelname: IGF2BP1 Rabbit Polyclonal Antibody, Unconjugated
Artikelnummer: BYT-ORB330140
Hersteller Artikelnummer: orb330140
Alternativnummer: BYT-ORB330140-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IHC, WB
Spezies Reaktivität: Human, Rat
Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human IGF2BP1
Konjugation: Unconjugated
Alternative Synonym: anti CRD-BP antibody, anti CRDBP antibody, anti IMP-1 antibody, anti IMP1 antibody, anti VIon ChannelKZ1 antibody, anti ZBP1 antibody, anti VICKZ1 antibody
Rabbit polyclonal antibody to IGF2BP1
Klonalität: Polyclonal
Konzentration: 0.5 mg/ml
Molekulargewicht: 63kDa
NCBI: 006537
UniProt: Q9NZI8
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequenz: Synthetic peptide located within the following region: PDEQIAQGPENGRRGGFGSRGQPRQGSPVAAGAPAKQQQVDIPLRLLVPT
Target-Kategorie: IGF2BP1
Sample Tissue: Rat Skeletal Muscle, Antibody Dilution: 1 ug/mL.
Sample Tissue: Rat Skeletal Muscle, Antibody Dilution: 1 ug/mL.
Application: IHC, Species+tissue/cell type: Human lung adenocarcinoma, Primary antibody Dilution: 1:300, Secondary antibody: Anti-rabbit-linker, Fbex-HRP, Secondary antibody Dilution: NOT FOUND.
Sample Type: Human lung adenocarcinoma, Primary Antibody Dilution: 1:300, Secondary Antibody: Anti-rabbit-linker, Fbex-HRP, Secondary Antibody Dilution: NOT FOUND, Color/Signal Descriptions: Brown: IGFBP1 Blue: Nuclei, Gene Name: IGF2BP1.
WB Suggested Anti-IGF2BP1 Antibody Titration: 0.2-1 ug/mL, ELISA Titer: 1:12500, Positive Control: HepG2 cell lysate.