IGF2BP1 Rabbit Polyclonal Antibody, Unconjugated

Catalog Number: BYT-ORB330140
Article Name: IGF2BP1 Rabbit Polyclonal Antibody, Unconjugated
Biozol Catalog Number: BYT-ORB330140
Supplier Catalog Number: orb330140
Alternative Catalog Number: BYT-ORB330140-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: IHC, WB
Species Reactivity: Human, Rat
Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human IGF2BP1
Conjugation: Unconjugated
Alternative Names: anti CRD-BP antibody, anti CRDBP antibody, anti IMP-1 antibody, anti IMP1 antibody, anti VIon ChannelKZ1 antibody, anti ZBP1 antibody, anti VICKZ1 antibody
Rabbit polyclonal antibody to IGF2BP1
Clonality: Polyclonal
Concentration: 0.5 mg/ml
Molecular Weight: 63kDa
NCBI: 006537
UniProt: Q9NZI8
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Form: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence: Synthetic peptide located within the following region: PDEQIAQGPENGRRGGFGSRGQPRQGSPVAAGAPAKQQQVDIPLRLLVPT
Target: IGF2BP1
Sample Tissue: Rat Skeletal Muscle, Antibody Dilution: 1 ug/mL.
Sample Tissue: Rat Skeletal Muscle, Antibody Dilution: 1 ug/mL.
Application: IHC, Species+tissue/cell type: Human lung adenocarcinoma, Primary antibody Dilution: 1:300, Secondary antibody: Anti-rabbit-linker, Fbex-HRP, Secondary antibody Dilution: NOT FOUND.
Sample Type: Human lung adenocarcinoma, Primary Antibody Dilution: 1:300, Secondary Antibody: Anti-rabbit-linker, Fbex-HRP, Secondary Antibody Dilution: NOT FOUND, Color/Signal Descriptions: Brown: IGFBP1 Blue: Nuclei, Gene Name: IGF2BP1.
WB Suggested Anti-IGF2BP1 Antibody Titration: 0.2-1 ug/mL, ELISA Titer: 1:12500, Positive Control: HepG2 cell lysate.