BHMT Rabbit Polyclonal Antibody, Unconjugated
Artikelnummer:
BYT-ORB330184
| Artikelname: |
BHMT Rabbit Polyclonal Antibody, Unconjugated |
| Artikelnummer: |
BYT-ORB330184 |
| Hersteller Artikelnummer: |
orb330184 |
| Alternativnummer: |
BYT-ORB330184-100 |
| Hersteller: |
Biorbyt |
| Wirt: |
Rabbit |
| Kategorie: |
Antikörper |
| Applikation: |
IHC, WB |
| Spezies Reaktivität: |
Human, Rat |
| Immunogen: |
The immunogen is a synthetic peptide directed towards the N terminal region of human BHMT |
| Konjugation: |
Unconjugated |
| Alternative Synonym: |
anti BHMT1 antibody |
| Rabbit polyclonal antibody to BHMT |
| Klonalität: |
Polyclonal |
| Konzentration: |
1.0 mg/ml |
| Molekulargewicht: |
45kDa |
| NCBI: |
001704 |
| UniProt: |
Q93088 |
| Puffer: |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Formulierung: |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Sequenz: |
Synthetic peptide located within the following region: AVEHPEAVRQLHREFLRAGSNVMQTFTFYASEDKLENRGNYVLEKISGQE |
| Target-Kategorie: |
BHMT |
![]()
|
Sample Type: 293T, Antibody Dilution: 1.0 ug/mL. |
![]()
|
Lanes: Lane 1: 20 ug rat liver lysate, Primary Antibody Dilution: 1:1000, Secondary Antibody: Anti-rabbit HRP, Secondary Antibody Dilution: 1:15000, Gene Name: BHMT. |
![]()
|
Lanes: Lane 1: 20 ug rat liver lysate, Primary Antibody Dilution: 1:2000, Secondary Antibody: Anti-rabbit HRP, Secondary Antibody Dilution: 1:15000, Gene Name: BHMT. |
![]()
|
Rabbit Anti-BHMT Antibody, Paraffin Embedded Tissue: Human Kidney, Cellular Data: Epithelial cells of renal tubule, Antibody Concentration: 4.0-8.0 ug/mL, Magnification: 400X. |
![]()
|
WB Suggested Anti-BHMT Antibody, Titration: 2.5 ug/mL, Positive Control: Human Fetal Liver cell lysate. |
