BHMT Rabbit Polyclonal Antibody, Unconjugated

Catalog Number: BYT-ORB330184
Article Name: BHMT Rabbit Polyclonal Antibody, Unconjugated
Biozol Catalog Number: BYT-ORB330184
Supplier Catalog Number: orb330184
Alternative Catalog Number: BYT-ORB330184-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: IHC, WB
Species Reactivity: Human, Rat
Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human BHMT
Conjugation: Unconjugated
Alternative Names: anti BHMT1 antibody
Rabbit polyclonal antibody to BHMT
Clonality: Polyclonal
Concentration: 1.0 mg/ml
Molecular Weight: 45kDa
NCBI: 001704
UniProt: Q93088
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Form: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence: Synthetic peptide located within the following region: AVEHPEAVRQLHREFLRAGSNVMQTFTFYASEDKLENRGNYVLEKISGQE
Target: BHMT
Sample Type: 293T, Antibody Dilution: 1.0 ug/mL.
Lanes: Lane 1: 20 ug rat liver lysate, Primary Antibody Dilution: 1:1000, Secondary Antibody: Anti-rabbit HRP, Secondary Antibody Dilution: 1:15000, Gene Name: BHMT.
Lanes: Lane 1: 20 ug rat liver lysate, Primary Antibody Dilution: 1:2000, Secondary Antibody: Anti-rabbit HRP, Secondary Antibody Dilution: 1:15000, Gene Name: BHMT.
Rabbit Anti-BHMT Antibody, Paraffin Embedded Tissue: Human Kidney, Cellular Data: Epithelial cells of renal tubule, Antibody Concentration: 4.0-8.0 ug/mL, Magnification: 400X.
WB Suggested Anti-BHMT Antibody, Titration: 2.5 ug/mL, Positive Control: Human Fetal Liver cell lysate.