SDHB Rabbit Polyclonal Antibody, Unconjugated
Artikelnummer:
BYT-ORB330526
- Bilder (6)
| Artikelname: | SDHB Rabbit Polyclonal Antibody, Unconjugated |
| Artikelnummer: | BYT-ORB330526 |
| Hersteller Artikelnummer: | orb330526 |
| Alternativnummer: | BYT-ORB330526-100 |
| Hersteller: | Biorbyt |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | WB |
| Spezies Reaktivität: | Human |
| Immunogen: | The immunogen is a synthetic peptide directed towards the middle region of human SDHB |
| Konjugation: | Unconjugated |
| Alternative Synonym: | anti IP antibody, anti PGL4 antibody, anti SDH antibody, anti SDH1 antibody, anti SDHIP antibody, anti SDH2 antibody |
| Rabbit polyclonal antibody to SDHB |
| Klonalität: | Polyclonal |
| Konzentration: | 0.5 mg/ml |
| Molekulargewicht: | 32 kDa |
| NCBI: | 002991 |
| UniProt: | P21912 |
| Puffer: | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Formulierung: | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Sequenz: | Synthetic peptide located within the following region: YRWMIDSRDDFTEERLAKLQDPFSLYRCHTIMNCTRTCPKGLNPGKAIAE |
| Target-Kategorie: | SDHB |
|
|
Sample Type: Human Fetal Liver, Antibody dilution: 1.0 ug/ml. |
|
|
Sample Type: Human Fetal Heart, Antibody dilution: 1.0 ug/ml. |
|
|
Sample Tissue: Human Fetal Lung, Antibody dilution: 1.0 ug/ml. |
|
|
Sample Type: Human Adult Placenta, Antibody dilution: 1.0 ug/ml. |
|
|
Positive control (+): Human Liver (LI), Negative control (-): Human Lung (LU), Antibody concentration: 1 ug/ml. |
|
|
WB Suggested Anti-SDHB Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:62500, Positive Control: Jurkat cell lysate, SDHB is supported by BioGPS gene expression data to be expressed in Jurkat. |
Produktgarantie und fachkundiger Support
