SDHB Rabbit Polyclonal Antibody, Unconjugated
Catalog Number:
BYT-ORB330526
- Images (6)
| Article Name: | SDHB Rabbit Polyclonal Antibody, Unconjugated |
| Biozol Catalog Number: | BYT-ORB330526 |
| Supplier Catalog Number: | orb330526 |
| Alternative Catalog Number: | BYT-ORB330526-100 |
| Manufacturer: | Biorbyt |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | WB |
| Species Reactivity: | Human |
| Immunogen: | The immunogen is a synthetic peptide directed towards the middle region of human SDHB |
| Conjugation: | Unconjugated |
| Alternative Names: | anti IP antibody, anti PGL4 antibody, anti SDH antibody, anti SDH1 antibody, anti SDHIP antibody, anti SDH2 antibody |
| Rabbit polyclonal antibody to SDHB |
| Clonality: | Polyclonal |
| Concentration: | 0.5 mg/ml |
| Molecular Weight: | 32 kDa |
| NCBI: | 002991 |
| UniProt: | P21912 |
| Buffer: | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Form: | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Sequence: | Synthetic peptide located within the following region: YRWMIDSRDDFTEERLAKLQDPFSLYRCHTIMNCTRTCPKGLNPGKAIAE |
| Target: | SDHB |
|
|
Sample Type: Human Fetal Liver, Antibody dilution: 1.0 ug/ml. |
|
|
Sample Type: Human Fetal Heart, Antibody dilution: 1.0 ug/ml. |
|
|
Sample Tissue: Human Fetal Lung, Antibody dilution: 1.0 ug/ml. |
|
|
Sample Type: Human Adult Placenta, Antibody dilution: 1.0 ug/ml. |
|
|
Positive control (+): Human Liver (LI), Negative control (-): Human Lung (LU), Antibody concentration: 1 ug/ml. |
|
|
WB Suggested Anti-SDHB Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:62500, Positive Control: Jurkat cell lysate, SDHB is supported by BioGPS gene expression data to be expressed in Jurkat. |
Product Guarantee and Expert Support
