ATG5 Rabbit Polyclonal Antibody, Unconjugated
Artikelnummer:
BYT-ORB330734
- Bilder (6)
| Artikelname: | ATG5 Rabbit Polyclonal Antibody, Unconjugated |
| Artikelnummer: | BYT-ORB330734 |
| Hersteller Artikelnummer: | orb330734 |
| Alternativnummer: | BYT-ORB330734-100 |
| Hersteller: | Biorbyt |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | IHC, WB |
| Spezies Reaktivität: | Human |
| Immunogen: | The immunogen is a synthetic peptide directed towards the C terminal region of human ATG5 |
| Konjugation: | Unconjugated |
| Alternative Synonym: | anti APG5 antibody, anti APG5L antibody, anti ASP antibody, anti hAPG5 antibody, anti APG5-LIKE antibody |
| Rabbit polyclonal antibody to ATG5 |
| Klonalität: | Polyclonal |
| Konzentration: | 0.5 mg/ml |
| Molekulargewicht: | 32kDa |
| NCBI: | 004840 |
| UniProt: | Q9H1Y0 |
| Puffer: | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Formulierung: | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Sequenz: | Synthetic peptide located within the following region: DPEDGEKKNQVMIHGIEPMLETPLQWLSEHLSYPDNFLHISIIPQPTD |
| Target-Kategorie: | ATG5 |
|
|
Sample Type: Human Fetal Heart, Antibody dilution: 1.0 ug/ml. |
|
|
Sample Type: Human Fetal Liver, Antibody dilution: 1.0 ug/ml. |
|
|
Sample Type: Human Fetal Lung, Antibody dilution: 1.0 ug/ml. |
|
|
Human Placenta |
|
|
Human Prostate |
|
|
WB Suggested Anti-ATG5 Antibody Titration: 1 ug/ml, Positive Control: HepG2 cell lysate. |
Produktgarantie und fachkundiger Support
