ATG5 Rabbit Polyclonal Antibody, Unconjugated
Catalog Number:
BYT-ORB330734
- Images (6)
| Article Name: | ATG5 Rabbit Polyclonal Antibody, Unconjugated |
| Biozol Catalog Number: | BYT-ORB330734 |
| Supplier Catalog Number: | orb330734 |
| Alternative Catalog Number: | BYT-ORB330734-100 |
| Manufacturer: | Biorbyt |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | IHC, WB |
| Species Reactivity: | Human |
| Immunogen: | The immunogen is a synthetic peptide directed towards the C terminal region of human ATG5 |
| Conjugation: | Unconjugated |
| Alternative Names: | anti APG5 antibody, anti APG5L antibody, anti ASP antibody, anti hAPG5 antibody, anti APG5-LIKE antibody |
| Rabbit polyclonal antibody to ATG5 |
| Clonality: | Polyclonal |
| Concentration: | 0.5 mg/ml |
| Molecular Weight: | 32kDa |
| NCBI: | 004840 |
| UniProt: | Q9H1Y0 |
| Buffer: | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Form: | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Sequence: | Synthetic peptide located within the following region: DPEDGEKKNQVMIHGIEPMLETPLQWLSEHLSYPDNFLHISIIPQPTD |
| Target: | ATG5 |
|
|
Sample Type: Human Fetal Heart, Antibody dilution: 1.0 ug/ml. |
|
|
Sample Type: Human Fetal Liver, Antibody dilution: 1.0 ug/ml. |
|
|
Sample Type: Human Fetal Lung, Antibody dilution: 1.0 ug/ml. |
|
|
Human Placenta |
|
|
Human Prostate |
|
|
WB Suggested Anti-ATG5 Antibody Titration: 1 ug/ml, Positive Control: HepG2 cell lysate. |
Product Guarantee and Expert Support
