FYN Rabbit Polyclonal Antibody, Unconjugated

Artikelnummer: BYT-ORB330812
Artikelname: FYN Rabbit Polyclonal Antibody, Unconjugated
Artikelnummer: BYT-ORB330812
Hersteller Artikelnummer: orb330812
Alternativnummer: BYT-ORB330812-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Human
Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human FYN
Konjugation: Unconjugated
Alternative Synonym: anti MGC45350 antibody, anti SLK antibody, anti SYN antibody, anti p59-FYN antibody
Rabbit polyclonal antibody to FYN
Klonalität: Polyclonal
Konzentration: 0.5 mg/ml
Molekulargewicht: 54kDa
NCBI: 694593
UniProt: P06241
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequenz: Synthetic peptide located within the following region: GCVQCKDKEATKLTEERDGSLNQSSGYRYGTDPTPQHYPSFGVTSIPNYN
Target-Kategorie: FYN
Sample Type: 293T, Antibody dilution: 1.0 ug/ml. FYN is strongly supported by BioGPS gene expression data to be expressed in Human HEK293T cells.
Sample Type: Human Adult Placenta, Antibody dilution: 1.0 ug/ml.
Sample Type: Human Fetal Lung, Antibody dilution: 1.0 ug/ml.
Rabbit Anti-FYN Antibody, Catalog Number: orb330812, Formalin Fixed Paraffin Embedded Tissue: Human Lymph Node Tissue, Observed Staining: Cytoplasm, Plasma membrane, Nucleus, Primary Antibody Concentration: 1:100, Other Working Concentrations: 1:600, Secondary Antibody: Donkey anti-Rabbit-Cy3, Secondary Antibody Concentration: 1:200, Magnification: 20X, Exposure Time: 0.5-2.0 sec.
WB Suggested Anti-FYN Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:12500, Positive Control: Human heart.