FYN Rabbit Polyclonal Antibody, Unconjugated
Catalog Number:
BYT-ORB330812
| Article Name: |
FYN Rabbit Polyclonal Antibody, Unconjugated |
| Biozol Catalog Number: |
BYT-ORB330812 |
| Supplier Catalog Number: |
orb330812 |
| Alternative Catalog Number: |
BYT-ORB330812-100 |
| Manufacturer: |
Biorbyt |
| Host: |
Rabbit |
| Category: |
Antikörper |
| Application: |
WB |
| Species Reactivity: |
Human |
| Immunogen: |
The immunogen is a synthetic peptide directed towards the N terminal region of human FYN |
| Conjugation: |
Unconjugated |
| Alternative Names: |
anti MGC45350 antibody, anti SLK antibody, anti SYN antibody, anti p59-FYN antibody |
| Rabbit polyclonal antibody to FYN |
| Clonality: |
Polyclonal |
| Concentration: |
0.5 mg/ml |
| Molecular Weight: |
54kDa |
| NCBI: |
694593 |
| UniProt: |
P06241 |
| Buffer: |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Form: |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Sequence: |
Synthetic peptide located within the following region: GCVQCKDKEATKLTEERDGSLNQSSGYRYGTDPTPQHYPSFGVTSIPNYN |
| Target: |
FYN |
![]()
|
Sample Type: 293T, Antibody dilution: 1.0 ug/ml. FYN is strongly supported by BioGPS gene expression data to be expressed in Human HEK293T cells. |
![]()
|
Sample Type: Human Adult Placenta, Antibody dilution: 1.0 ug/ml. |
![]()
|
Sample Type: Human Fetal Lung, Antibody dilution: 1.0 ug/ml. |
![]()
|
Rabbit Anti-FYN Antibody, Catalog Number: orb330812, Formalin Fixed Paraffin Embedded Tissue: Human Lymph Node Tissue, Observed Staining: Cytoplasm, Plasma membrane, Nucleus, Primary Antibody Concentration: 1:100, Other Working Concentrations: 1:600, Secondary Antibody: Donkey anti-Rabbit-Cy3, Secondary Antibody Concentration: 1:200, Magnification: 20X, Exposure Time: 0.5-2.0 sec. |
![]()
|
WB Suggested Anti-FYN Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:12500, Positive Control: Human heart. |
