PRKAA2 Rabbit Polyclonal Antibody, Unconjugated
Artikelnummer:
BYT-ORB330884
| Artikelname: |
PRKAA2 Rabbit Polyclonal Antibody, Unconjugated |
| Artikelnummer: |
BYT-ORB330884 |
| Hersteller Artikelnummer: |
orb330884 |
| Alternativnummer: |
BYT-ORB330884-100 |
| Hersteller: |
Biorbyt |
| Wirt: |
Rabbit |
| Kategorie: |
Antikörper |
| Applikation: |
WB |
| Spezies Reaktivität: |
Human, Mouse, Rat |
| Immunogen: |
The immunogen is a synthetic peptide directed towards the middle region of human PRKAA2 |
| Konjugation: |
Unconjugated |
| Alternative Synonym: |
anti AMPK antibody, anti AMPK2 antibody, anti PRKAA antibody, anti AMPKa2 antibody |
| Rabbit polyclonal antibody to PRKAA2 |
| Klonalität: |
Polyclonal |
| Konzentration: |
0.5 mg/ml |
| Molekulargewicht: |
62kDa |
| NCBI: |
006243 |
| UniProt: |
P54646 |
| Puffer: |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Formulierung: |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Sequenz: |
Synthetic peptide located within the following region: AYHLIIDNRRIMNQASEFYLASSPPSGSFMDDSAMHIPPGLKPHPERMPP |
| Target-Kategorie: |
PRKAA2 |
![]()
|
Sample Type: rat hepatocyte (50 ug), Primary dilution: 1:4000, Secondary Antibody:Donkey anti-Rabbit HRP, Secondary dilution: 1:10000. |
![]()
|
Sample Tissue: Mouse Skeletal Muscle, Antibody dilution: 1 ug/ml. |
![]()
|
Sample Tissue: Mouse Skeletal Muscle, Antibody dilution: 1 ug/ml. |
![]()
|
PRKAA2 antibody - middle region (orb330884) validated by WB using Rat Liver, Human Muscle, Rat Muscle, Mouse Muscle at 1:1000. |
![]()
|
WB Suggested Anti-PRKAA2 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:1562500, Positive Control: Jurkat cell lysate. |
