PRKAA2 Rabbit Polyclonal Antibody, Unconjugated
Catalog Number:
BYT-ORB330884
| Article Name: |
PRKAA2 Rabbit Polyclonal Antibody, Unconjugated |
| Biozol Catalog Number: |
BYT-ORB330884 |
| Supplier Catalog Number: |
orb330884 |
| Alternative Catalog Number: |
BYT-ORB330884-100 |
| Manufacturer: |
Biorbyt |
| Host: |
Rabbit |
| Category: |
Antikörper |
| Application: |
WB |
| Species Reactivity: |
Human, Mouse, Rat |
| Immunogen: |
The immunogen is a synthetic peptide directed towards the middle region of human PRKAA2 |
| Conjugation: |
Unconjugated |
| Alternative Names: |
anti AMPK antibody, anti AMPK2 antibody, anti PRKAA antibody, anti AMPKa2 antibody |
| Rabbit polyclonal antibody to PRKAA2 |
| Clonality: |
Polyclonal |
| Concentration: |
0.5 mg/ml |
| Molecular Weight: |
62kDa |
| NCBI: |
006243 |
| UniProt: |
P54646 |
| Buffer: |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Form: |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Sequence: |
Synthetic peptide located within the following region: AYHLIIDNRRIMNQASEFYLASSPPSGSFMDDSAMHIPPGLKPHPERMPP |
| Target: |
PRKAA2 |
![]()
|
Sample Type: rat hepatocyte (50 ug), Primary dilution: 1:4000, Secondary Antibody:Donkey anti-Rabbit HRP, Secondary dilution: 1:10000. |
![]()
|
Sample Tissue: Mouse Skeletal Muscle, Antibody dilution: 1 ug/ml. |
![]()
|
Sample Tissue: Mouse Skeletal Muscle, Antibody dilution: 1 ug/ml. |
![]()
|
PRKAA2 antibody - middle region (orb330884) validated by WB using Rat Liver, Human Muscle, Rat Muscle, Mouse Muscle at 1:1000. |
![]()
|
WB Suggested Anti-PRKAA2 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:1562500, Positive Control: Jurkat cell lysate. |
