Warenkorb

Produktsuche

Home
Produkte
Syt1 Rabbit Polyclonal Antibody, Unconjugated

Syt1 Rabbit Polyclonal Antibody, Unconjugated

Artikelnummer: BYT-ORB331045

Bilder (5)
Sehen Sie alle Bilder und Bildinformationen

Artikelname:	Syt1 Rabbit Polyclonal Antibody, Unconjugated
Artikelnummer:	BYT-ORB331045
Hersteller Artikelnummer:	orb331045
Alternativnummer:	BYT-ORB331045-100
Hersteller:	Biorbyt
Wirt:	Rabbit
Kategorie:	Antikörper
Applikation:	IHC, WB
Spezies Reaktivität:	Mouse
Immunogen:	The immunogen is a synthetic peptide corresponding to a region of Mouse
Konjugation:	Unconjugated
Alternative Synonym:	anti AW124717 antibody, anti G630098F17Rik antibody, anti SytI antibody

Rabbit polyclonal antibody to Syt1

Klonalität:	Polyclonal
Konzentration:	0.5 mg/ml
Molekulargewicht:	47kDa
NCBI:	033332
UniProt:	P46096
Puffer:	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Formulierung:	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequenz:	Synthetic peptide located within the following region: FDRFSKHDIIGEFKVPMNTVDFGHVTEEWRDLQSAEKEEQEKLGDICFSL
Target-Kategorie:	Syt1

	Sample Type: complete mouse retina sections, Red: Primary, Blue: DAPI, Primary dilution: 1:200, Secondary Antibody: Goat anti-Rabbit AF568 IgG(H+L), Secondary dilution: 1:200.
	Sample Type: outer mouse plexiform layer, Red: Primary, Blue: DAPI, Primary dilution: 1:200, Secondary Antibody: Goat anti-Rabbit AF568 IgG(H+L), Secondary dilution: 1:200.
	25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 3 ug/ml of the antibody was used in this experiment. The protein is lipidated and may be phosphorylated.
	Lanes: Lane 1: 10 ug mouse cortex brain lysate, Lane 2: 25 ug mouse cortex brain lysate, Lane 3: 40 ug mouse cortex brain lysate, Primary Antibody dilution: 1:1000, Secondary Antibody: Anti-rabbit HRP, Secondary Antibody dilution: 1:2000, Gene Name: Syt1.
	Syt1 antibody - middle region (orb331045) validated by WB using Mouse Spleen lysate at 1.0 ug/ml.

* Mehrwertsteuer und Versandkosten nicht enthalten.
Irrtümer und Preisänderungen vorbehalten