Syt1 Rabbit Polyclonal Antibody, Unconjugated

Catalog Number: BYT-ORB331045
Article Name: Syt1 Rabbit Polyclonal Antibody, Unconjugated
Biozol Catalog Number: BYT-ORB331045
Supplier Catalog Number: orb331045
Alternative Catalog Number: BYT-ORB331045-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: IHC, WB
Species Reactivity: Mouse
Immunogen: The immunogen is a synthetic peptide corresponding to a region of Mouse
Conjugation: Unconjugated
Alternative Names: anti AW124717 antibody, anti G630098F17Rik antibody, anti SytI antibody
Rabbit polyclonal antibody to Syt1
Clonality: Polyclonal
Concentration: 0.5 mg/ml
Molecular Weight: 47kDa
NCBI: 033332
UniProt: P46096
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Form: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence: Synthetic peptide located within the following region: FDRFSKHDIIGEFKVPMNTVDFGHVTEEWRDLQSAEKEEQEKLGDICFSL
Target: Syt1
Sample Type: complete mouse retina sections, Red: Primary, Blue: DAPI, Primary dilution: 1:200, Secondary Antibody: Goat anti-Rabbit AF568 IgG(H+L), Secondary dilution: 1:200.
Sample Type: outer mouse plexiform layer, Red: Primary, Blue: DAPI, Primary dilution: 1:200, Secondary Antibody: Goat anti-Rabbit AF568 IgG(H+L), Secondary dilution: 1:200.
25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 3 ug/ml of the antibody was used in this experiment. The protein is lipidated and may be phosphorylated.
Lanes: Lane 1: 10 ug mouse cortex brain lysate, Lane 2: 25 ug mouse cortex brain lysate, Lane 3: 40 ug mouse cortex brain lysate, Primary Antibody dilution: 1:1000, Secondary Antibody: Anti-rabbit HRP, Secondary Antibody dilution: 1:2000, Gene Name: Syt1.
Syt1 antibody - middle region (orb331045) validated by WB using Mouse Spleen lysate at 1.0 ug/ml.
568,00 €
100 ul
* VAT and and shipping costs not included.
Errors and price changes excepted
Availability
ORDER BY EMAIL
Product Guarantee and Expert Support
BIOZOL