CAPZB Rabbit Polyclonal Antibody, Unconjugated
Artikelnummer:
BYT-ORB331478
- Bilder (6)
| Artikelname: | CAPZB Rabbit Polyclonal Antibody, Unconjugated |
| Artikelnummer: | BYT-ORB331478 |
| Hersteller Artikelnummer: | orb331478 |
| Alternativnummer: | BYT-ORB331478-100 |
| Hersteller: | Biorbyt |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | WB |
| Spezies Reaktivität: | Human |
| Immunogen: | The immunogen is a synthetic peptide directed towards the N-terminal region of Human CAPZB |
| Konjugation: | Unconjugated |
| Alternative Synonym: | anti CAPZB antibody, anti antibody |
| Rabbit polyclonal antibody to CAPZB |
| Klonalität: | Polyclonal |
| Konzentration: | 0.5 mg/ml |
| Molekulargewicht: | 31 kDa |
| UniProt: | P47756 |
| Puffer: | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Formulierung: | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Sequenz: | Synthetic peptide located within the following region: PLKIARDKVVGKDYLLCDYNRDGDSYRSPWSNKYDPPLEDGAMPSARLRK |
| Target-Kategorie: | CAPZB |
|
|
25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 3 ug/ml of the antibody was used in this experiment. |
|
|
Sample Tissue: Human 786-0 Whole Cell, Antibody dilution: 3 ug/ml. |
|
|
Sample Tissue: Human HepG2 Whole Cell, Antibody dilution: 3 ug/ml. |
|
|
Sample Tissue: Human Jurkat Whole Cell, Antibody dilution: 1 ug/ml. |
|
|
Sample Tissue: Human PANC1 Whole Cell, Antibody dilution: 3 ug/ml. |
|
|
Sample Type: 293T Whole Cell lysates, Antibody dilution: 1.0 ug/ml. |
Produktgarantie und fachkundiger Support
