CAPZB Rabbit Polyclonal Antibody, Unconjugated
Catalog Number:
BYT-ORB331478
- Images (6)
| Article Name: | CAPZB Rabbit Polyclonal Antibody, Unconjugated |
| Biozol Catalog Number: | BYT-ORB331478 |
| Supplier Catalog Number: | orb331478 |
| Alternative Catalog Number: | BYT-ORB331478-100 |
| Manufacturer: | Biorbyt |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | WB |
| Species Reactivity: | Human |
| Immunogen: | The immunogen is a synthetic peptide directed towards the N-terminal region of Human CAPZB |
| Conjugation: | Unconjugated |
| Alternative Names: | anti CAPZB antibody, anti antibody |
| Rabbit polyclonal antibody to CAPZB |
| Clonality: | Polyclonal |
| Concentration: | 0.5 mg/ml |
| Molecular Weight: | 31 kDa |
| UniProt: | P47756 |
| Buffer: | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Form: | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Sequence: | Synthetic peptide located within the following region: PLKIARDKVVGKDYLLCDYNRDGDSYRSPWSNKYDPPLEDGAMPSARLRK |
| Target: | CAPZB |
|
|
25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 3 ug/ml of the antibody was used in this experiment. |
|
|
Sample Tissue: Human 786-0 Whole Cell, Antibody dilution: 3 ug/ml. |
|
|
Sample Tissue: Human HepG2 Whole Cell, Antibody dilution: 3 ug/ml. |
|
|
Sample Tissue: Human Jurkat Whole Cell, Antibody dilution: 1 ug/ml. |
|
|
Sample Tissue: Human PANC1 Whole Cell, Antibody dilution: 3 ug/ml. |
|
|
Sample Type: 293T Whole Cell lysates, Antibody dilution: 1.0 ug/ml. |
Product Guarantee and Expert Support
