Human CYP17A1 protein

Artikelnummer: BYT-ORB358083
Artikelname: Human CYP17A1 protein
Artikelnummer: BYT-ORB358083
Hersteller Artikelnummer: orb358083
Alternativnummer: BYT-ORB358083-20,BYT-ORB358083-100,BYT-ORB358083-1
Hersteller: Biorbyt
Kategorie: Proteine/Peptide
Alternative Synonym: 17-alpha-hydroxyprogesterone aldolaseCYPXVIICytochrome P450 17A1Cytochrome P450-C17 , Cytochrome P450c17Steroid 17-alpha-monooxygenase
This Human CYP17A1 protein spans the amino acid sequence from region 1-508aa. Purity: Greater than 90% as determined by SDS-PAGE.
Molekulargewicht: 84.4 kDa
UniProt: P05093
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Quelle: Homo sapiens (Human)
Reinheit: Greater than 90% as determined by SDS-PAGE.
Formulierung: Liquid or Lyophilized powder
Sequenz: MWELVALLLLTLAYLFWPKRRCPGAKYPKSLLSLPLVGSLPFLPRHGHMHNNFFKLQKKYGPIYSVRMGTKTTVIVGHHQLAKEVLIKKGKDFSGRPQMATLDIASNNRKGIAFADSGAHWQLHRRLAMATFALFKDGDQKLEKIICQEISTLCDMLATHNGQSIDISFPVFVAVTNVISLICFNTSYKNGDPELNVIQNYNEGIIDNLSKDSLVDLVPWLKIFPNKTLEKLKSHVKIRNDLLNKILENYKEKFR
Anwendungsbeschreibung: Biological Origin: Homo sapiens (Human). Application Notes: Full length of GST-tag and expression region is 1-508aa
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.