Human CYP17A1 protein

Catalog Number: BYT-ORB358083
Article Name: Human CYP17A1 protein
Biozol Catalog Number: BYT-ORB358083
Supplier Catalog Number: orb358083
Alternative Catalog Number: BYT-ORB358083-20,BYT-ORB358083-100,BYT-ORB358083-1
Manufacturer: Biorbyt
Category: Proteine/Peptide
Alternative Names: 17-alpha-hydroxyprogesterone aldolaseCYPXVIICytochrome P450 17A1Cytochrome P450-C17 , Cytochrome P450c17Steroid 17-alpha-monooxygenase
This Human CYP17A1 protein spans the amino acid sequence from region 1-508aa. Purity: Greater than 90% as determined by SDS-PAGE.
Molecular Weight: 84.4 kDa
UniProt: P05093
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: Homo sapiens (Human)
Purity: Greater than 90% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: MWELVALLLLTLAYLFWPKRRCPGAKYPKSLLSLPLVGSLPFLPRHGHMHNNFFKLQKKYGPIYSVRMGTKTTVIVGHHQLAKEVLIKKGKDFSGRPQMATLDIASNNRKGIAFADSGAHWQLHRRLAMATFALFKDGDQKLEKIICQEISTLCDMLATHNGQSIDISFPVFVAVTNVISLICFNTSYKNGDPELNVIQNYNEGIIDNLSKDSLVDLVPWLKIFPNKTLEKLKSHVKIRNDLLNKILENYKEKFR
Application Notes: Biological Origin: Homo sapiens (Human). Application Notes: Full length of GST-tag and expression region is 1-508aa
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.